BLASTX nr result
ID: Mentha22_contig00049703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00049703 (532 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobr... 79 9e-13 ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus ... 78 1e-12 gb|EYU22175.1| hypothetical protein MIMGU_mgv1a002211mg [Mimulus... 77 2e-12 ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prun... 76 4e-12 gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta] 75 1e-11 ref|XP_004515872.1| PREDICTED: ferric reduction oxidase 8, mitoc... 74 2e-11 ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitoc... 74 2e-11 ref|XP_002321628.1| ferric reductase-like transmembrane componen... 72 8e-11 ref|XP_004299137.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduc... 71 1e-10 ref|XP_002277760.1| PREDICTED: ferric reduction oxidase 8, mitoc... 71 2e-10 ref|XP_002318065.1| ferric reductase-like transmembrane componen... 71 2e-10 gb|EXB93548.1| Ferric reduction oxidase 8 [Morus notabilis] 70 2e-10 ref|XP_007155475.1| hypothetical protein PHAVU_003G204400g [Phas... 70 2e-10 ref|XP_004168892.1| PREDICTED: ferric reduction oxidase 8, mitoc... 69 7e-10 ref|XP_004140645.1| PREDICTED: ferric reduction oxidase 8, mitoc... 69 7e-10 ref|XP_006344463.1| PREDICTED: ferric reduction oxidase 8, mitoc... 69 9e-10 ref|XP_004236257.1| PREDICTED: ferric reduction oxidase 8, mitoc... 69 9e-10 ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitoc... 63 4e-08 ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citr... 63 4e-08 ref|XP_002864039.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrat... 62 1e-07 >ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao] gi|508773566|gb|EOY20822.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao] Length = 720 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +3 Query: 396 SGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 +GW+SLW+LKPT FWTR WK AEA A TVFGY GLDF YTFP+ Sbjct: 19 TGWISLWLLKPTNFWTRKWKGAEASAQDTVFGYYGLDFAVYTFPV 63 >ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus communis] gi|223550445|gb|EEF51932.1| ferric-chelate reductase, putative [Ricinus communis] Length = 726 Score = 77.8 bits (190), Expect = 1e-12 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+GWV++W+LKPT WTR WK+AE A +TVFGY GLDF YTFP+ Sbjct: 18 FAGWVAIWILKPTNLWTRKWKEAEDSARSTVFGYYGLDFAVYTFPI 63 >gb|EYU22175.1| hypothetical protein MIMGU_mgv1a002211mg [Mimulus guttatus] Length = 701 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASA-TVFGYNGLDFVAYTFPL 530 F+GW+S+WVLKPTEFWT+ WK AE KA+A ++F YNGLDFV Y FPL Sbjct: 14 FAGWLSIWVLKPTEFWTQKWKAAEEKANASSIFRYNGLDFVVYAFPL 60 >ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica] gi|462406473|gb|EMJ11937.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica] Length = 687 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFP 527 F+ WVSLW+LKPT+ WTR WK AE KA ATVFGY GL+F YTFP Sbjct: 18 FAAWVSLWLLKPTQLWTRKWKAAEDKARATVFGYYGLNFAVYTFP 62 >gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta] Length = 722 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+GWVSLW+LKPT WTR WK E A T+FGY GLDF YTFP+ Sbjct: 18 FAGWVSLWLLKPTNLWTRKWKGVEDSARPTIFGYYGLDFAVYTFPV 63 >ref|XP_004515872.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cicer arietinum] Length = 714 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 396 SGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 +GW+SLW+LKPT+ WT TWK AE A+ T+FGY GL+FV YTFP+ Sbjct: 19 AGWISLWLLKPTQVWTTTWKHAEQSANNTIFGYYGLNFVVYTFPV 63 >ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Glycine max] Length = 711 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+GWVSLW+LKPT+ WTR WK AE A+ T+FGY GL F Y FP+ Sbjct: 20 FAGWVSLWLLKPTQIWTRKWKQAEDSANDTIFGYYGLSFAVYAFPI 65 >ref|XP_002321628.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] gi|222868624|gb|EEF05755.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] Length = 722 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+GW+++W+ KPT WTR WK AE +S TVFGY GL+F YTFPL Sbjct: 18 FAGWIAVWIQKPTNMWTRKWKGAEDSSSYTVFGYYGLNFAVYTFPL 63 >ref|XP_004299137.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 8, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 704 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+ WVSLW++KPT+FWTR WK AE A T+FGY GL+F Y FPL Sbjct: 18 FAAWVSLWLIKPTQFWTREWKAAEDLARPTLFGYYGLNFAVYIFPL 63 >ref|XP_002277760.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Vitis vinifera] gi|297733716|emb|CBI14963.3| unnamed protein product [Vitis vinifera] Length = 703 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +3 Query: 396 SGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 +GW++LW+LKPT+ WT+ W AE A TVFGY GL+FV YTFP+ Sbjct: 18 AGWITLWILKPTQLWTKKWHTAEDSARTTVFGYYGLNFVVYTFPV 62 >ref|XP_002318065.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] gi|222858738|gb|EEE96285.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] Length = 743 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFP 527 F+GW++LW+LKPT WTR WK AE A TVFGY GL+F +TFP Sbjct: 18 FAGWIALWLLKPTNLWTRKWKGAEDSARHTVFGYYGLNFAVFTFP 62 >gb|EXB93548.1| Ferric reduction oxidase 8 [Morus notabilis] Length = 711 Score = 70.5 bits (171), Expect = 2e-10 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+GW+SLW+LKPT+ WTR WK+ E + T+ GY G++FV +TFP+ Sbjct: 18 FAGWISLWLLKPTQIWTRKWKEVEERLRPTILGYYGINFVVFTFPV 63 >ref|XP_007155475.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris] gi|561028829|gb|ESW27469.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris] Length = 709 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+ WVSLW LKPT+ WTR WK E A T+FGY GL F YTFP+ Sbjct: 20 FAAWVSLWFLKPTQIWTRKWKQLENSADNTIFGYYGLSFAVYTFPI 65 >ref|XP_004168892.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cucumis sativus] Length = 716 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +3 Query: 396 SGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 +GW+SLW+LKPT+ WT+ W AE A A++FGY GL+FV YTFP+ Sbjct: 24 AGWISLWLLKPTDLWTKKWHLAENSARASLFGYYGLNFVVYTFPV 68 >ref|XP_004140645.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cucumis sativus] Length = 716 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +3 Query: 396 SGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 +GW+SLW+LKPT+ WT+ W AE A A++FGY GL+FV YTFP+ Sbjct: 24 AGWISLWLLKPTDLWTKKWHLAENSARASLFGYYGLNFVVYTFPV 68 >ref|XP_006344463.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Solanum tuberosum] Length = 699 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+GW+S+W+LKPT+ WT+TWK AE KASA+ +GL+F YTFP+ Sbjct: 16 FAGWLSVWLLKPTQLWTKTWKLAEKKASASFLTQSGLNFAVYTFPV 61 >ref|XP_004236257.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Solanum lycopersicum] Length = 699 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +3 Query: 393 FSGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 F+GW+S+W+LKPT+ WT+TWK AE KASA+ +GL+F YTFP+ Sbjct: 16 FAGWLSVWLLKPTQLWTKTWKLAEKKASASFLTQSGLNFAVYTFPV 61 >ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Citrus sinensis] Length = 713 Score = 63.2 bits (152), Expect = 4e-08 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = +3 Query: 396 SGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 + W++LW+LKPT WT+ W +AE +A T+FGY GL+F TFP+ Sbjct: 18 AAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPV 62 >ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citrus clementina] gi|557542174|gb|ESR53152.1| hypothetical protein CICLE_v10019061mg [Citrus clementina] Length = 713 Score = 63.2 bits (152), Expect = 4e-08 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = +3 Query: 396 SGWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFPL 530 + W++LW+LKPT WT+ W +AE +A T+FGY GL+F TFP+ Sbjct: 18 AAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPV 62 >ref|XP_002864039.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata] gi|297309874|gb|EFH40298.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata] Length = 728 Score = 61.6 bits (148), Expect = 1e-07 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +3 Query: 399 GWVSLWVLKPTEFWTRTWKDAEAKASATVFGYNGLDFVAYTFP 527 GW+SLW++KPT W ++W+ AE A T FGY GL+F ++FP Sbjct: 20 GWISLWIIKPTTLWIQSWRQAEDTAKHTFFGYYGLNFAVFSFP 62