BLASTX nr result
ID: Mentha22_contig00048313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00048313 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32093.1| hypothetical protein MIMGU_mgv1a016809mg [Mimulus... 65 1e-08 ref|XP_006438063.1| hypothetical protein CICLE_v10033355mg, part... 61 1e-07 gb|EXC06142.1| hypothetical protein L484_005463 [Morus notabilis] 58 2e-06 emb|CAN80085.1| hypothetical protein VITISV_011295 [Vitis vinifera] 57 3e-06 ref|XP_002514941.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >gb|EYU32093.1| hypothetical protein MIMGU_mgv1a016809mg [Mimulus guttatus] Length = 106 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 295 MEEDGLRAKSFRYEDYNTRRVFLRSYPLHWG 387 MEEDG+RA+SFR EDYNTRRVFLRSYPLHWG Sbjct: 1 MEEDGIRARSFRDEDYNTRRVFLRSYPLHWG 31 >ref|XP_006438063.1| hypothetical protein CICLE_v10033355mg, partial [Citrus clementina] gi|557540259|gb|ESR51303.1| hypothetical protein CICLE_v10033355mg, partial [Citrus clementina] Length = 140 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 283 DIGGMEEDGLRAKSFRYEDYNTRRVFLRSYPLHWG 387 D GMEE+G+R +SFR +DYN RRVFLRSYPLHWG Sbjct: 38 DRKGMEENGMRTRSFRNKDYNNRRVFLRSYPLHWG 72 >gb|EXC06142.1| hypothetical protein L484_005463 [Morus notabilis] Length = 114 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 277 KEDIGGMEEDGLRAKSFRYEDYNTRRVFLRSYPLHWG 387 +E+ G +DGLR++SFR EDYNTRRVFLRSYPL WG Sbjct: 7 EENGKGPGQDGLRSRSFRDEDYNTRRVFLRSYPLRWG 43 >emb|CAN80085.1| hypothetical protein VITISV_011295 [Vitis vinifera] Length = 112 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 295 MEEDGLRAKSFRYEDYNTRRVFLRSYPLHWG 387 ME++G+RA+SFR EDYN RRVFLRSYPL WG Sbjct: 1 MEDNGMRARSFRNEDYNNRRVFLRSYPLDWG 31 >ref|XP_002514941.1| conserved hypothetical protein [Ricinus communis] gi|223545992|gb|EEF47495.1| conserved hypothetical protein [Ricinus communis] Length = 156 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +1 Query: 295 MEEDGLRAKSFRYEDYNTRRVFLRSYPLHW 384 ME +G+R +SFRYEDYN RRVFLRSYPL W Sbjct: 1 MEANGMRTRSFRYEDYNNRRVFLRSYPLQW 30