BLASTX nr result
ID: Mentha22_contig00048274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00048274 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32259.1| hypothetical protein MIMGU_mgv1a021930mg [Mimulus... 60 3e-07 >gb|EYU32259.1| hypothetical protein MIMGU_mgv1a021930mg [Mimulus guttatus] Length = 500 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 469 DAQFASGSEKVFHTFVVKSDAPERLTKEKLLEAMSRESN 353 DAQ A+GSE+VFHTFVVKS+ +RLTKEK++EA SR SN Sbjct: 460 DAQMATGSERVFHTFVVKSNGSDRLTKEKMIEAFSRGSN 498