BLASTX nr result
ID: Mentha22_contig00048071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00048071 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18989.1| hypothetical protein MIMGU_mgv1a002337mg [Mimulus... 77 2e-12 gb|EPS62629.1| hypothetical protein M569_12158 [Genlisea aurea] 64 2e-08 >gb|EYU18989.1| hypothetical protein MIMGU_mgv1a002337mg [Mimulus guttatus] Length = 687 Score = 77.0 bits (188), Expect = 2e-12 Identities = 43/80 (53%), Positives = 53/80 (66%), Gaps = 1/80 (1%) Frame = +2 Query: 110 MDPWFSEPNTANEFKYDDGSFFP-SYEYDQSQNLKNGTRHDYLELDVLDIPLLPLSPGPD 286 MDP F+ NT+N F +DD +F S +Y+QSQN NG HDYLEL+V+D PD Sbjct: 1 MDPRFNIHNTSNGFNFDDENFDKFSPDYEQSQNHTNGIIHDYLELNVMDY--------PD 52 Query: 287 NFAPSSSVSYEAESPDDLDS 346 +FA SS+ SYE ESPDD DS Sbjct: 53 SFALSSTTSYETESPDDQDS 72 >gb|EPS62629.1| hypothetical protein M569_12158 [Genlisea aurea] Length = 693 Score = 64.3 bits (155), Expect = 2e-08 Identities = 39/80 (48%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +2 Query: 110 MDPWFSEPNTA-NEFKYDDGSFFPSYEYDQSQNLKNGTRHDYLELDVLDIPLLPLSPGPD 286 MDP SE +TA N FK ++G+F S Q L +G HD L LD DIP ++P D Sbjct: 1 MDPRLSEMSTAVNGFKLENGNF--SSSLGQLPYLDDGINHD-LGLDDFDIPFFAVTPEID 57 Query: 287 NFAPSSSVSYEAESPDDLDS 346 +F PSS+ SYE SPDDL+S Sbjct: 58 SFGPSSTTSYETRSPDDLES 77