BLASTX nr result
ID: Mentha22_contig00048015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00048015 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29177.1| hypothetical protein MIMGU_mgv1a003039mg [Mimulus... 61 1e-07 >gb|EYU29177.1| hypothetical protein MIMGU_mgv1a003039mg [Mimulus guttatus] Length = 613 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/64 (53%), Positives = 40/64 (62%), Gaps = 6/64 (9%) Frame = +1 Query: 172 MIHGAQPTRLVPPAMSA----LCCYTSVPPRHLRKRYASKPSKWP--RPPPAASDQLNLK 333 MIH A P L+ PA S+ L C T+ PPRHLRK +K KWP RP +SD LNLK Sbjct: 1 MIHAAAPAILLSPAPSSIHPTLLCSTATPPRHLRKHLPNKRRKWPDTRPQTPSSDPLNLK 60 Query: 334 SLTA 345 SLT+ Sbjct: 61 SLTS 64