BLASTX nr result
ID: Mentha22_contig00046476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00046476 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40575.1| hypothetical protein MIMGU_mgv1a004589mg [Mimulus... 55 8e-06 >gb|EYU40575.1| hypothetical protein MIMGU_mgv1a004589mg [Mimulus guttatus] Length = 519 Score = 55.5 bits (132), Expect = 8e-06 Identities = 36/79 (45%), Positives = 41/79 (51%), Gaps = 28/79 (35%) Frame = -1 Query: 419 SFNAYEYFWR----------------SKPGFMGTNKKKMNQDLVL-----------YMRG 321 SFNAYEYFWR +K G G N+DLV+ Y+RG Sbjct: 441 SFNAYEYFWRNKTAVYGGGGGGAQLKNKDGDGGAEAAYENKDLVVVKGKKTEYSVPYLRG 500 Query: 320 CKEARRSL-LREPYCIATS 267 CKEARRSL + EPYCIATS Sbjct: 501 CKEARRSLSIWEPYCIATS 519