BLASTX nr result
ID: Mentha22_contig00046253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00046253 (1120 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30282.1| hypothetical protein MIMGU_mgv1a004150mg [Mimulus... 60 2e-06 >gb|EYU30282.1| hypothetical protein MIMGU_mgv1a004150mg [Mimulus guttatus] Length = 541 Score = 59.7 bits (143), Expect = 2e-06 Identities = 33/80 (41%), Positives = 51/80 (63%), Gaps = 4/80 (5%) Frame = +2 Query: 767 QPGVDCREEDFGSQGKSEAKGTCKSNQTKSLAIALPQRR----SVSGLQKESYSVGTSVE 934 QP VD E+D GSQ K++ K K+ + S A++ ++ S S ++K+SYSVG +VE Sbjct: 236 QPRVDNLEKDLGSQDKTDVKRQRKNKKKSSSAVSPTKKSNSVISCSTVEKDSYSVGPTVE 295 Query: 935 DHIAPELPVNCPENKVKTLS 994 D ++PVNC NK+K+L+ Sbjct: 296 DLSNLDMPVNCETNKMKSLN 315