BLASTX nr result
ID: Mentha22_contig00046039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00046039 (641 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44778.1| hypothetical protein MIMGU_mgv1a008498mg [Mimulus... 59 1e-06 >gb|EYU44778.1| hypothetical protein MIMGU_mgv1a008498mg [Mimulus guttatus] Length = 371 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 522 MKRRSNSGKFHHRWKRKFLAFLLIAICFATFLSMESEYSK 641 MKRRS+ KFHHRW+RKF A LL C ATFL ME+E+S+ Sbjct: 1 MKRRSSLQKFHHRWRRKFFALLLFLFCVATFLLMEAEHSR 40