BLASTX nr result
ID: Mentha22_contig00045621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00045621 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citr... 59 5e-07 >ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] gi|557522886|gb|ESR34253.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/65 (50%), Positives = 36/65 (55%) Frame = +1 Query: 139 SYPGGGKGKQRDIGHLPKTNKIAMAKKIILFDYFPRVAASQYGNRPTIKFLSIHHVPTLI 318 SYPGGG GKQRDI K + K +YFP VA Q N P LS+HHVPT I Sbjct: 6 SYPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFP-VALFQERNEPVTMLLSMHHVPTFI 64 Query: 319 SSLEN 333 SS N Sbjct: 65 SSFNN 69