BLASTX nr result
ID: Mentha22_contig00045549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00045549 (683 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384814.1| hypothetical protein POPTR_0004s21310g [Popu... 62 1e-07 ref|XP_006384813.1| hypothetical protein POPTR_0004s21310g [Popu... 62 1e-07 ref|XP_002312817.2| hypothetical protein POPTR_0009s16560g [Popu... 59 1e-06 ref|XP_006384815.1| hypothetical protein POPTR_0004s21320g [Popu... 59 2e-06 >ref|XP_006384814.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] gi|550341582|gb|ERP62611.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] Length = 190 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = -3 Query: 411 KEEVS--VVIPEKWGQENLLKDWIDYSTFDELLAPKEAGS 298 +EEV+ V+IP+ WGQENLLKDWID STFDELLAPKE S Sbjct: 128 REEVAGRVMIPDTWGQENLLKDWIDCSTFDELLAPKEISS 167 >ref|XP_006384813.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] gi|550341581|gb|ERP62610.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] Length = 147 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = -3 Query: 411 KEEVS--VVIPEKWGQENLLKDWIDYSTFDELLAPKEAGS 298 +EEV+ V+IP+ WGQENLLKDWID STFDELLAPKE S Sbjct: 87 REEVAGRVMIPDTWGQENLLKDWIDCSTFDELLAPKEISS 126 >ref|XP_002312817.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa] gi|550331870|gb|EEE86772.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa] Length = 159 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 459 LKNEPSSQEKPMMSQCKEEVS--VVIPEKWGQENLLKDWIDYSTFDELLAP 313 L + SS + + + +EEVS V+IPE WGQE+LL DWIDYS+FD+LLAP Sbjct: 83 LMRKESSTGRERLKRHREEVSGKVMIPETWGQEDLLTDWIDYSSFDKLLAP 133 >ref|XP_006384815.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa] gi|550341583|gb|ERP62612.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa] Length = 159 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 2/36 (5%) Frame = -3 Query: 411 KEEVS--VVIPEKWGQENLLKDWIDYSTFDELLAPK 310 +EEVS V+IP+ WGQENLL DWIDYS+FD+LLAPK Sbjct: 95 REEVSGKVMIPDTWGQENLLTDWIDYSSFDKLLAPK 130