BLASTX nr result
ID: Mentha22_contig00044438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00044438 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71668.1| hypothetical protein M569_03091 [Genlisea aurea] 67 3e-09 gb|EPS70582.1| hypothetical protein M569_04176 [Genlisea aurea] 65 1e-08 >gb|EPS71668.1| hypothetical protein M569_03091 [Genlisea aurea] Length = 343 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 226 FPMRIQPIDSIPSDVVKPPVLKSRLKRLFDRPFNGVLR 339 F RIQPIDSI D VKPPVLKSRLKRLFDRPFNGVL+ Sbjct: 3 FQARIQPIDSILGDAVKPPVLKSRLKRLFDRPFNGVLK 40 >gb|EPS70582.1| hypothetical protein M569_04176 [Genlisea aurea] Length = 371 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +1 Query: 232 MRIQPIDSIPSDVVKPPVLKSRLKRLFDRPFNGVLR 339 MRIQPIDSIPSD VKP VLKSRLKRLFDRPF G L+ Sbjct: 1 MRIQPIDSIPSDAVKPAVLKSRLKRLFDRPFAGALK 36