BLASTX nr result
ID: Mentha22_contig00043164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00043164 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21722.1| hypothetical protein MIMGU_mgv1a002818mg [Mimulus... 55 8e-07 >gb|EYU21722.1| hypothetical protein MIMGU_mgv1a002818mg [Mimulus guttatus] Length = 634 Score = 54.7 bits (130), Expect(2) = 8e-07 Identities = 21/47 (44%), Positives = 33/47 (70%) Frame = +3 Query: 129 DLTDSQVNEYKELSYKLFQFRTHRLRSSNGGFGCPFCDHKEEHENRY 269 D +DS++NEYKE Y+L + TH++R NG F CPFC K++ + ++ Sbjct: 10 DFSDSEINEYKEKPYELLKAGTHKVRGPNGSFRCPFCAGKKKQDYQF 56 Score = 23.9 bits (50), Expect(2) = 8e-07 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 323 KKRANHFAMAKYLAIDLVHK 382 K++ANH A+A +L DL ++ Sbjct: 76 KQKANHLALATFLENDLANE 95