BLASTX nr result
ID: Mentha22_contig00042810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00042810 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41048.1| hypothetical protein MIMGU_mgv1a002349mg [Mimulus... 64 2e-08 gb|EPS58901.1| hypothetical protein M569_15911, partial [Genlise... 55 8e-06 >gb|EYU41048.1| hypothetical protein MIMGU_mgv1a002349mg [Mimulus guttatus] Length = 685 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/41 (75%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +2 Query: 194 MSFDEGEKQWKCV--APVSFQRVSSIVRDIGEPCLYQSPLK 310 MSFD KQWKCV + V+FQRVSSIVRDIGEPCL+QSP+K Sbjct: 1 MSFDGDVKQWKCVKGSQVNFQRVSSIVRDIGEPCLHQSPIK 41 >gb|EPS58901.1| hypothetical protein M569_15911, partial [Genlisea aurea] Length = 204 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = +2 Query: 194 MSFDEGEKQWKCVA--PVSFQRVSSIVRDIGEPCLYQSPLK 310 MSFD E W+CV V FQRVSS+ RDIGEPCL+Q+P+K Sbjct: 1 MSFDGKENPWRCVKGRTVHFQRVSSLFRDIGEPCLHQTPIK 41