BLASTX nr result
ID: Mentha22_contig00042588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00042588 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28684.1| hypothetical protein MIMGU_mgv1a005673mg [Mimulus... 56 6e-06 gb|EYU28683.1| hypothetical protein MIMGU_mgv1a005673mg [Mimulus... 56 6e-06 gb|EPS57599.1| hypothetical protein M569_17218, partial [Genlise... 55 8e-06 >gb|EYU28684.1| hypothetical protein MIMGU_mgv1a005673mg [Mimulus guttatus] Length = 475 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +2 Query: 2 KREGAPFLWSLLEKACLILGRE-EAASYGEKVKQLESSYFT 121 +REGAPFLW L EKA ILG++ EAASYGEK ++LE+++FT Sbjct: 435 EREGAPFLWFLTEKAYSILGKDAEAASYGEKARKLEATHFT 475 >gb|EYU28683.1| hypothetical protein MIMGU_mgv1a005673mg [Mimulus guttatus] Length = 433 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +2 Query: 2 KREGAPFLWSLLEKACLILGRE-EAASYGEKVKQLESSYFT 121 +REGAPFLW L EKA ILG++ EAASYGEK ++LE+++FT Sbjct: 393 EREGAPFLWFLTEKAYSILGKDAEAASYGEKARKLEATHFT 433 >gb|EPS57599.1| hypothetical protein M569_17218, partial [Genlisea aurea] Length = 281 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 6/46 (13%) Frame = +2 Query: 2 KREGAPFLWSLLEKACLILG------REEAASYGEKVKQLESSYFT 121 KREGAPFLWSLLE+ ILG EEAASYG+K ++L + YFT Sbjct: 232 KREGAPFLWSLLERGHAILGSEEGEEEEEAASYGKKARELAAKYFT 277