BLASTX nr result
ID: Mentha22_contig00042291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00042291 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24335.1| hypothetical protein MIMGU_mgv1a004902mg [Mimulus... 82 8e-14 >gb|EYU24335.1| hypothetical protein MIMGU_mgv1a004902mg [Mimulus guttatus] Length = 505 Score = 82.0 bits (201), Expect = 8e-14 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = +3 Query: 105 NSNSCRYLCFPVKLPKFRRTHVSLCTKNGVFEEFKDTLVSKRADNDEEFEGLELLNKPSP 284 +SNSCR +KL KFRRTH++ CTKNGVFEEFKDTL+S++ +N+E ELLNKPSP Sbjct: 42 SSNSCRTSFPALKLSKFRRTHITFCTKNGVFEEFKDTLLSRKPENEEP----ELLNKPSP 97 Query: 285 KQ 290 KQ Sbjct: 98 KQ 99