BLASTX nr result
ID: Mentha22_contig00042219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00042219 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70319.1| hypothetical protein M569_04441, partial [Genlise... 57 2e-06 >gb|EPS70319.1| hypothetical protein M569_04441, partial [Genlisea aurea] Length = 1623 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +3 Query: 78 SFNLADYVSQSHRLKEEAADVFRLVGKWLAKTRSAS 185 + NLA+Y+SQ+H+LK+E DVFRLVGKWLA+TRS++ Sbjct: 1003 AINLAEYISQNHQLKDEGPDVFRLVGKWLAETRSSN 1038