BLASTX nr result
ID: Mentha22_contig00042146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00042146 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25185.1| hypothetical protein MIMGU_mgv1a022857mg, partial... 60 4e-07 >gb|EYU25185.1| hypothetical protein MIMGU_mgv1a022857mg, partial [Mimulus guttatus] Length = 334 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 113 MQSKGSSLRFTGMVIRSRISVLMFSMFATFASLYVAG 3 MQSKGSS RFTGM IRSR+S L+ SMFA FASLYVAG Sbjct: 1 MQSKGSSTRFTGMGIRSRMSTLLLSMFAAFASLYVAG 37