BLASTX nr result
ID: Mentha22_contig00041435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041435 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34896.1| hypothetical protein MIMGU_mgv1a007616mg [Mimulus... 69 5e-10 >gb|EYU34896.1| hypothetical protein MIMGU_mgv1a007616mg [Mimulus guttatus] Length = 401 Score = 69.3 bits (168), Expect = 5e-10 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 20/103 (19%) Frame = -1 Query: 254 MDNCGDSRSTSTRKPLRKKRSNLNRRPS--NESESP-QEYRDSISLSSTPSDLVSDAPSV 84 MDN G ++ KP R++RSNLNRRP +ES+SP QE RDSISLSSTPSD VSDAP+ Sbjct: 1 MDNYGVHTAS---KPSRRRRSNLNRRPPTPHESDSPKQENRDSISLSSTPSDHVSDAPTE 57 Query: 83 GK-----------------ESSTPSLNLADADTLEESIDLKSS 6 G S+ NL++A+T+ ES D K S Sbjct: 58 GNIVQEATIWSKGLNSNQFISTASCTNLSEAETMHESNDDKES 100