BLASTX nr result
ID: Mentha22_contig00041383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041383 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27354.1| hypothetical protein MIMGU_mgv1a015673mg [Mimulus... 75 7e-12 gb|EPS63018.1| hypothetical protein M569_11771 [Genlisea aurea] 64 2e-08 >gb|EYU27354.1| hypothetical protein MIMGU_mgv1a015673mg [Mimulus guttatus] Length = 149 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +2 Query: 50 MIDRIHYYIKEVRMLRKHMEAIKRSEHKSEDAKTKEKGKSKAENDDD 190 MIDRIHYYI+EVRMLRKHMEAIK+S+ +SE+ K K+KGK+K DDD Sbjct: 103 MIDRIHYYIREVRMLRKHMEAIKKSDQESEELKIKDKGKNKVVEDDD 149 >gb|EPS63018.1| hypothetical protein M569_11771 [Genlisea aurea] Length = 147 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +2 Query: 50 MIDRIHYYIKEVRMLRKHMEAIKRSEHKSEDAKTKEKGKSKAENDDD 190 MIDRIHYYIKEVRMLRKH+EA+K+ + K +DA KGK KA +D++ Sbjct: 103 MIDRIHYYIKEVRMLRKHLEAVKKMDKKPQDA----KGKGKASDDEE 145