BLASTX nr result
ID: Mentha22_contig00041193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041193 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35871.1| hypothetical protein MIMGU_mgv1a000845mg [Mimulus... 68 1e-09 >gb|EYU35871.1| hypothetical protein MIMGU_mgv1a000845mg [Mimulus guttatus] Length = 963 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 406 LCISGYSDEMPIPSHVQFEAASSANISGRRRQIHGIVIDPSQITDSDLR 260 LCISGYS+ +PIPSHV +S+ GR RQ+ GIVIDPSQI DSDLR Sbjct: 915 LCISGYSESIPIPSHVDLPPPTSSTPHGRNRQLRGIVIDPSQILDSDLR 963