BLASTX nr result
ID: Mentha22_contig00041039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041039 (989 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETV90233.1| hypothetical protein H310_14935 [Aphanomyces inva... 60 1e-06 gb|ABD32507.1| transposase, putative [Medicago truncatula] 58 7e-06 >gb|ETV90233.1| hypothetical protein H310_14935 [Aphanomyces invadans] Length = 367 Score = 60.5 bits (145), Expect = 1e-06 Identities = 27/72 (37%), Positives = 44/72 (61%) Frame = +2 Query: 2 MTLNKVFLTLQCVFQEILKYKGHNNFKQPHMKKDSLLRQGILPRNLEIPMYLVRECVDFL 181 MTLN FLTLQC +E+++ G+N++K PHMKK L +G+LP +++ + + + L Sbjct: 288 MTLNANFLTLQCCMKEVIRVAGNNSYKVPHMKKAKLAAKGMLPDGVDVDSDTINDGFNLL 347 Query: 182 IGEQCTDGIEEL 217 + +EEL Sbjct: 348 CATDMDERVEEL 359 >gb|ABD32507.1| transposase, putative [Medicago truncatula] Length = 153 Score = 57.8 bits (138), Expect = 7e-06 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = +2 Query: 11 NKVFLTLQCVFQEILKYKGHNNFKQPHMKKDSLLRQGILPRNLEIPMYLVRECVDFL 181 N +FLTLQ EI+K KG NN+K PHM K+ LLR+ +LP+ L+ L +E ++L Sbjct: 91 NNIFLTLQSCMIEIMKVKGSNNYKIPHMDKEMLLRRSMLPKQLKCDPELFQETFEYL 147