BLASTX nr result
ID: Mentha22_contig00041003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041003 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40573.1| hypothetical protein MIMGU_mgv1a016042mg [Mimulus... 63 5e-08 gb|EYU30463.1| hypothetical protein MIMGU_mgv1a015975mg [Mimulus... 61 1e-07 gb|EPS74239.1| hypothetical protein M569_00515, partial [Genlise... 59 5e-07 ref|XP_006363909.1| PREDICTED: protein cornichon homolog 4-like ... 56 5e-06 ref|XP_004242012.1| PREDICTED: protein cornichon homolog 4-like ... 56 6e-06 >gb|EYU40573.1| hypothetical protein MIMGU_mgv1a016042mg [Mimulus guttatus] Length = 136 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 302 ERLFKLGYIILLLFMCLFWMIYNALEDDE 216 +RLFKLGY+ILLLFMCLFWMIYNALEDDE Sbjct: 108 QRLFKLGYVILLLFMCLFWMIYNALEDDE 136 >gb|EYU30463.1| hypothetical protein MIMGU_mgv1a015975mg [Mimulus guttatus] Length = 139 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 302 ERLFKLGYIILLLFMCLFWMIYNALEDDEHS 210 +RLFKLGY ILL+FMCLFWMIY ALE+DEHS Sbjct: 108 QRLFKLGYTILLIFMCLFWMIYKALEEDEHS 138 >gb|EPS74239.1| hypothetical protein M569_00515, partial [Genlisea aurea] Length = 138 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 302 ERLFKLGYIILLLFMCLFWMIYNALEDDEHS 210 +RL KLGY++LLLFMCLFWMIY+ALE+D+HS Sbjct: 108 QRLVKLGYLVLLLFMCLFWMIYSALEEDDHS 138 >ref|XP_006363909.1| PREDICTED: protein cornichon homolog 4-like [Solanum tuberosum] Length = 139 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 302 ERLFKLGYIILLLFMCLFWMIYNALEDDEHS 210 +RLFKLGYIILLLF+ LFW+IY+ALEDDE S Sbjct: 108 QRLFKLGYIILLLFISLFWLIYSALEDDEES 138 >ref|XP_004242012.1| PREDICTED: protein cornichon homolog 4-like [Solanum lycopersicum] Length = 139 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 302 ERLFKLGYIILLLFMCLFWMIYNALEDDEHS 210 +RLFKLGYI+LLLF+ LFW+IY+ALEDDE S Sbjct: 108 QRLFKLGYIVLLLFISLFWLIYSALEDDEES 138