BLASTX nr result
ID: Mentha22_contig00040315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00040315 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17761.1| hypothetical protein MIMGU_mgv1a000811mg [Mimulus... 59 7e-07 >gb|EYU17761.1| hypothetical protein MIMGU_mgv1a000811mg [Mimulus guttatus] gi|604297549|gb|EYU17762.1| hypothetical protein MIMGU_mgv1a000811mg [Mimulus guttatus] Length = 977 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/59 (44%), Positives = 42/59 (71%) Frame = +3 Query: 3 RHCYDLEGIPSEIGYIGPLELMELVDCSPRAVESAEDIQQEQEGFDKKALQVRVYCSYE 179 RHCY+L IP + +G LEL+ELVDCSP AVE+AE+++++ + L+++ Y S++ Sbjct: 919 RHCYELVDIPEKFDLLGCLELIELVDCSPDAVEAAEEMKKKLKKSGNTLLKIQTYSSWK 977