BLASTX nr result
ID: Mentha22_contig00040303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00040303 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24079.1| hypothetical protein MIMGU_mgv1a000797mg [Mimulus... 76 4e-12 >gb|EYU24079.1| hypothetical protein MIMGU_mgv1a000797mg [Mimulus guttatus] Length = 983 Score = 76.3 bits (186), Expect = 4e-12 Identities = 49/111 (44%), Positives = 59/111 (53%), Gaps = 3/111 (2%) Frame = +1 Query: 1 IWTNHENYDSLLLTDALSGKLHAASELSHARRSSRLNEEKPPEGIGVREGPNEARIDDKQ 180 IWTNHE YDSLLLTDALSG+ H ASE H R + K E N + D Sbjct: 507 IWTNHEQYDSLLLTDALSGRFHGASEWRHDRND---GDSKQKETASCN---NATVLPDNN 560 Query: 181 KEANGVVKADESGSSGWPHCWDLLKD---SNSSVDDVKASDLPPPASSETG 324 +G V+A+ES S WP CWDLLKD SN + K +LP + +G Sbjct: 561 ---SGSVRANESPS--WPQCWDLLKDDEVSNGPQNTEKIPNLPNQNETTSG 606