BLASTX nr result
ID: Mentha22_contig00039814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00039814 (531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44672.1| hypothetical protein MIMGU_mgv1a007071mg [Mimulus... 60 2e-07 >gb|EYU44672.1| hypothetical protein MIMGU_mgv1a007071mg [Mimulus guttatus] Length = 420 Score = 60.5 bits (145), Expect = 2e-07 Identities = 42/88 (47%), Positives = 46/88 (52%), Gaps = 1/88 (1%) Frame = -2 Query: 281 MPLGLLSNLNXXXXXXXXXXXRVKQYQSLHLIEALFLQKTFNCSTHTMATCCCSKVARGD 102 MP LL NLN RV Q Q LHLIE LF + S S VA GD Sbjct: 1 MPSWLLPNLNVALSFGFPRAARVNQSQPLHLIETLFTR-----SGKNRMAASSSMVASGD 55 Query: 101 VVVDKLLSS-GSFSGFVKPSSVYLGSRS 21 VVVD LLSS G+ SGF+KP V+ G RS Sbjct: 56 VVVDTLLSSCGNVSGFLKPGGVFYGDRS 83