BLASTX nr result
ID: Mentha22_contig00039790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00039790 (442 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q8S9H7.1|DIV_ANTMA RecName: Full=Transcription factor DIVARIC... 83 3e-14 ref|XP_002525595.1| DNA binding protein, putative [Ricinus commu... 61 1e-07 ref|XP_002314123.1| syringolide-induced protein 1-3-1B [Populus ... 60 2e-07 >sp|Q8S9H7.1|DIV_ANTMA RecName: Full=Transcription factor DIVARICATA gi|18874263|gb|AAL78741.1| MYB-like transcription factor DIVARICATA [Antirrhinum majus] Length = 307 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 3/75 (4%) Frame = -1 Query: 442 KLPYQWSPTGNEAVMGFTSLCHGNNMFTSSSPYGMNSYAIKLQRGLVNHH---DSFMGSQ 272 KLP+QW T NE +MGF S H NMF S+P+GMNSY K+Q + D+++GSQ Sbjct: 234 KLPFQWDQTSNETIMGFASSGHHGNMF-QSNPFGMNSYGFKMQGQQMQRGGFCDTYLGSQ 292 Query: 271 NVAFQMQTELHYPNA 227 N+AFQMQ+ LH+PNA Sbjct: 293 NMAFQMQSGLHFPNA 307 >ref|XP_002525595.1| DNA binding protein, putative [Ricinus communis] gi|223535031|gb|EEF36713.1| DNA binding protein, putative [Ricinus communis] Length = 307 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 4/72 (5%) Frame = -1 Query: 433 YQWSPTGNEAVMGFTSLCHGNNMFTSSSPYGMNSYAIKLQRGLVNH----HDSFMGSQNV 266 +QW+ + A+M F S NMFTSS+ YG+NSY +KLQ G H H+S++G Q + Sbjct: 239 FQWNQPNSGAIMAFNST--NGNMFTSST-YGVNSYGMKLQ-GYNLHSGSLHESYIGPQTI 294 Query: 265 AFQMQTELHYPN 230 AFQMQ+ HYP+ Sbjct: 295 AFQMQSAQHYPD 306 >ref|XP_002314123.1| syringolide-induced protein 1-3-1B [Populus trichocarpa] gi|222850531|gb|EEE88078.1| syringolide-induced protein 1-3-1B [Populus trichocarpa] Length = 308 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/73 (46%), Positives = 45/73 (61%), Gaps = 5/73 (6%) Frame = -1 Query: 433 YQWSPTGNEAVMGFTSLCHGNNMFTSSSPYGMNSYAIKLQ-----RGLVNHHDSFMGSQN 269 +QW+ + A M F S NMF SS PYG+NSY +K+Q RG V HDS++G Q Sbjct: 240 FQWNQPNSGATMAFNST--NANMFMSS-PYGINSYGLKMQGQNPHRGAV--HDSYIGQQT 294 Query: 268 VAFQMQTELHYPN 230 + FQMQ+ HYP+ Sbjct: 295 MGFQMQSAQHYPH 307