BLASTX nr result
ID: Mentha22_contig00039772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00039772 (866 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005705790.1| omega-6 fatty acid desaturase (delta-12 desa... 59 2e-06 >ref|XP_005705790.1| omega-6 fatty acid desaturase (delta-12 desaturase) [Galdieria sulphuraria] gi|452822249|gb|EME29270.1| omega-6 fatty acid desaturase (delta-12 desaturase) [Galdieria sulphuraria] Length = 385 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/95 (28%), Positives = 56/95 (58%) Frame = -2 Query: 646 KPDWQPAMHQLLFTSVSLAISVYFLSSNSYVIYPFALLFTCFSFCLLHLIAMDCVHQLFT 467 K W+ A +L T ++ ++ ++++ +S+ P A +T ++ L +IA DC H+ F Sbjct: 69 KDPWK-ASFCVLLTVIASSLGIFWIHKSSWFFLPLAWFYTGTAWTGLFVIAHDCGHRAFA 127 Query: 466 PSQLFNRLLGELTLFPFVQPFESFTLEEKVSVENS 362 S+L N ++G L+L P + PFE++ ++ + +N+ Sbjct: 128 KSRLVNDIVGTLSLLPLIYPFEAWRIQHNIHHQNT 162