BLASTX nr result
ID: Mentha22_contig00039138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00039138 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43468.1| hypothetical protein MIMGU_mgv1a019296mg [Mimulus... 66 4e-09 gb|EYU38111.1| hypothetical protein MIMGU_mgv1a004302mg [Mimulus... 66 4e-09 ref|XP_007050748.1| Transducin family protein / WD-40 repeat fam... 64 2e-08 ref|XP_002321043.1| transducin family protein [Populus trichocar... 64 2e-08 ref|XP_004148880.1| PREDICTED: U3 small nucleolar RNA-associated... 62 1e-07 gb|EXC34667.1| U3 small nucleolar RNA-associated protein 15-like... 61 1e-07 ref|XP_002524308.1| U3 small nucleolar RNA-associated protein, p... 61 1e-07 ref|XP_006348622.1| PREDICTED: U3 small nucleolar RNA-associated... 61 2e-07 gb|EPS68334.1| hypothetical protein M569_06434, partial [Genlise... 61 2e-07 ref|XP_004239002.1| PREDICTED: U3 small nucleolar RNA-associated... 61 2e-07 emb|CBI32284.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002270535.1| PREDICTED: U3 small nucleolar RNA-associated... 61 2e-07 ref|XP_006444200.1| hypothetical protein CICLE_v10019671mg [Citr... 60 3e-07 ref|XP_007223119.1| hypothetical protein PRUPE_ppa003776mg [Prun... 60 4e-07 ref|XP_007144576.1| hypothetical protein PHAVU_007G167300g [Phas... 58 2e-06 ref|XP_004496004.1| PREDICTED: U3 small nucleolar RNA-associated... 57 3e-06 ref|XP_004301843.1| PREDICTED: U3 small nucleolar RNA-associated... 56 5e-06 ref|XP_003637374.1| U3 small nucleolar RNA-associated protein-li... 56 5e-06 ref|XP_003591585.1| U3 small nucleolar RNA-associated protein-li... 56 5e-06 >gb|EYU43468.1| hypothetical protein MIMGU_mgv1a019296mg [Mimulus guttatus] Length = 534 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +3 Query: 9 RNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 RN+IRNLKRDVEEE+R+Q SLLE+QGI+SPMLRIA +R Sbjct: 497 RNHIRNLKRDVEEELRVQQSLLEVQGIISPMLRIAGKR 534 >gb|EYU38111.1| hypothetical protein MIMGU_mgv1a004302mg [Mimulus guttatus] Length = 534 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +3 Query: 9 RNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 RN+IRNLKRDVEEE+R+Q SLLE+QGI+SPMLRIA +R Sbjct: 497 RNHIRNLKRDVEEELRVQQSLLEVQGIISPMLRIAGKR 534 >ref|XP_007050748.1| Transducin family protein / WD-40 repeat family protein [Theobroma cacao] gi|508703009|gb|EOX94905.1| Transducin family protein / WD-40 repeat family protein [Theobroma cacao] Length = 539 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAAR 119 L+ +IRNLKR +EEEIRIQHSLLEIQGI+SP+LRIA R Sbjct: 501 LKGHIRNLKRSIEEEIRIQHSLLEIQGIISPLLRIAGR 538 >ref|XP_002321043.1| transducin family protein [Populus trichocarpa] gi|222861816|gb|EEE99358.1| transducin family protein [Populus trichocarpa] Length = 534 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 L+ +IRNLKR VEEEIRIQHSL EIQG++SP+LRIA RR Sbjct: 496 LKGHIRNLKRSVEEEIRIQHSLQEIQGVISPLLRIAGRR 534 >ref|XP_004148880.1| PREDICTED: U3 small nucleolar RNA-associated protein 15 homolog [Cucumis sativus] gi|449528790|ref|XP_004171386.1| PREDICTED: U3 small nucleolar RNA-associated protein 15 homolog [Cucumis sativus] Length = 528 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAAR 119 L++++RNLKR VEEEIRIQ SLLEIQGI+SP+LRIA R Sbjct: 491 LKDHVRNLKRSVEEEIRIQQSLLEIQGIISPLLRIAGR 528 >gb|EXC34667.1| U3 small nucleolar RNA-associated protein 15-like protein [Morus notabilis] Length = 531 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = +3 Query: 3 QLRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 +L++++RNLKR VEEEIRIQ SL EIQGI+SP+LR+A RR Sbjct: 492 ELKSHVRNLKRSVEEEIRIQQSLQEIQGIISPLLRLAGRR 531 >ref|XP_002524308.1| U3 small nucleolar RNA-associated protein, putative [Ricinus communis] gi|223536399|gb|EEF38048.1| U3 small nucleolar RNA-associated protein, putative [Ricinus communis] Length = 525 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 L+ +IRNLKR VEEEIRI H+L EIQGI+SP+LRIA RR Sbjct: 487 LKGHIRNLKRSVEEEIRIHHALQEIQGIISPLLRIAGRR 525 >ref|XP_006348622.1| PREDICTED: U3 small nucleolar RNA-associated protein 15 homolog [Solanum tuberosum] Length = 533 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +3 Query: 3 QLRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 +LR IRNLKRDVEEEIR+Q +LL+IQGIV+P+L+IA RR Sbjct: 494 ELRGDIRNLKRDVEEEIRLQQTLLQIQGIVTPLLKIAGRR 533 >gb|EPS68334.1| hypothetical protein M569_06434, partial [Genlisea aurea] Length = 539 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 3 QLRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 QLR ++RNLK+ VEEE RIQ SLLEIQGIVSP+L+IAA+R Sbjct: 499 QLREHLRNLKQAVEEETRIQQSLLEIQGIVSPILKIAAKR 538 >ref|XP_004239002.1| PREDICTED: U3 small nucleolar RNA-associated protein 15 homolog [Solanum lycopersicum] Length = 533 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +3 Query: 3 QLRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 +LR IRNLKRDVEEEIR+Q +LL+IQGIV+P+L+IA RR Sbjct: 494 ELRGDIRNLKRDVEEEIRLQQTLLQIQGIVTPLLKIAGRR 533 >emb|CBI32284.3| unnamed protein product [Vitis vinifera] Length = 460 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 L+ +IRNLKR VEEE+RIQ SL EIQGI+SP+LRIA RR Sbjct: 422 LKGHIRNLKRSVEEEVRIQQSLQEIQGIISPLLRIAGRR 460 >ref|XP_002270535.1| PREDICTED: U3 small nucleolar RNA-associated protein 15 homolog [Vitis vinifera] Length = 528 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 L+ +IRNLKR VEEE+RIQ SL EIQGI+SP+LRIA RR Sbjct: 490 LKGHIRNLKRSVEEEVRIQQSLQEIQGIISPLLRIAGRR 528 >ref|XP_006444200.1| hypothetical protein CICLE_v10019671mg [Citrus clementina] gi|568852351|ref|XP_006479841.1| PREDICTED: U3 small nucleolar RNA-associated protein 15 homolog [Citrus sinensis] gi|557546462|gb|ESR57440.1| hypothetical protein CICLE_v10019671mg [Citrus clementina] Length = 532 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 L+ +IRNLKR VEEEIRIQ SL EIQGI+SP+LRIA +R Sbjct: 494 LKGHIRNLKRSVEEEIRIQQSLQEIQGIISPLLRIAGKR 532 >ref|XP_007223119.1| hypothetical protein PRUPE_ppa003776mg [Prunus persica] gi|462420055|gb|EMJ24318.1| hypothetical protein PRUPE_ppa003776mg [Prunus persica] Length = 550 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 L+ +IRNLKR VEEEIRIQ SL EIQGI+SP+LRI RR Sbjct: 512 LKGHIRNLKRSVEEEIRIQQSLQEIQGIISPLLRITGRR 550 >ref|XP_007144576.1| hypothetical protein PHAVU_007G167300g [Phaseolus vulgaris] gi|561017766|gb|ESW16570.1| hypothetical protein PHAVU_007G167300g [Phaseolus vulgaris] Length = 496 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAAR 119 L++++RNLKR VEEEIR+Q SL EIQGI+SP+L+IA R Sbjct: 459 LKSHVRNLKRSVEEEIRVQQSLQEIQGIISPLLKIAGR 496 >ref|XP_004496004.1| PREDICTED: U3 small nucleolar RNA-associated protein 15 homolog [Cicer arietinum] Length = 525 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 LR +IRNLK VE EIR+Q SL EIQGI+SP+LRIA RR Sbjct: 487 LRKHIRNLKSTVEAEIRVQQSLQEIQGIISPLLRIAGRR 525 >ref|XP_004301843.1| PREDICTED: U3 small nucleolar RNA-associated protein 15 homolog [Fragaria vesca subsp. vesca] Length = 546 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 QLRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 +L+ IRN+KR VEEEIRIQ SL EIQG++SP+LRI RR Sbjct: 507 ELKGLIRNIKRAVEEEIRIQLSLQEIQGVISPLLRITGRR 546 >ref|XP_003637374.1| U3 small nucleolar RNA-associated protein-like protein, partial [Medicago truncatula] gi|355503309|gb|AES84512.1| U3 small nucleolar RNA-associated protein-like protein, partial [Medicago truncatula] Length = 452 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 L+ +IRNLK VE EIRIQ SL EIQGI+SP+LRIA RR Sbjct: 414 LKKHIRNLKSTVEAEIRIQQSLQEIQGIISPLLRIAGRR 452 >ref|XP_003591585.1| U3 small nucleolar RNA-associated protein-like protein [Medicago truncatula] gi|357442643|ref|XP_003591599.1| U3 small nucleolar RNA-associated protein-like protein [Medicago truncatula] gi|355480633|gb|AES61836.1| U3 small nucleolar RNA-associated protein-like protein [Medicago truncatula] gi|355480647|gb|AES61850.1| U3 small nucleolar RNA-associated protein-like protein [Medicago truncatula] Length = 530 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 6 LRNYIRNLKRDVEEEIRIQHSLLEIQGIVSPMLRIAARR 122 L+ +IRNLK VE EIRIQ SL EIQGI+SP+LRIA RR Sbjct: 492 LKKHIRNLKSTVEAEIRIQQSLQEIQGIISPLLRIAGRR 530