BLASTX nr result
ID: Mentha22_contig00039106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00039106 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32338.1| hypothetical protein MIMGU_mgv1a000544mg [Mimulus... 92 1e-16 ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic su... 89 5e-16 ref|XP_007013842.1| Cellulose synthase 1 [Theobroma cacao] gi|50... 89 8e-16 gb|AGC97433.2| cellulose synthase [Boehmeria nivea] 88 1e-15 gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] 88 1e-15 gb|AFZ78556.1| cellulose synthase [Populus tomentosa] 87 2e-15 ref|XP_002308657.1| cellulose synthase family protein [Populus t... 87 2e-15 gb|AAO25536.1| cellulose synthase [Populus tremuloides] 87 2e-15 gb|AFB18635.1| CESA6 [Gossypium hirsutum] 87 2e-15 gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium h... 87 2e-15 ref|XP_007221583.1| hypothetical protein PRUPE_ppa000611mg [Prun... 87 3e-15 ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UD... 87 3e-15 ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic su... 86 5e-15 ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic su... 86 5e-15 gb|AAP97497.1| cellulose synthase [Solanum tuberosum] 86 5e-15 ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic su... 82 6e-14 ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citr... 82 6e-14 gb|AAT66940.1| CesA1 [Acacia mangium] 82 6e-14 ref|XP_002324291.1| TGACG-motif binding family protein [Populus ... 82 8e-14 gb|AFZ78558.1| cellulose synthase [Populus tomentosa] 82 1e-13 >gb|EYU32338.1| hypothetical protein MIMGU_mgv1a000544mg [Mimulus guttatus] Length = 1084 Score = 91.7 bits (226), Expect = 1e-16 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWS+LLASIFSLLWVRIDPFTSDATK+AAQGQCGVNC Sbjct: 1041 RTPTIVIVWSVLLASIFSLLWVRIDPFTSDATKKAAQGQCGVNC 1084 >ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Fragaria vesca subsp. vesca] Length = 1069 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATK AA+GQCGVNC Sbjct: 1026 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKAAAKGQCGVNC 1069 >ref|XP_007013842.1| Cellulose synthase 1 [Theobroma cacao] gi|508784205|gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao] Length = 1085 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATK AA GQCG+NC Sbjct: 1042 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKSAANGQCGINC 1085 >gb|AGC97433.2| cellulose synthase [Boehmeria nivea] Length = 1082 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATK A++GQCGVNC Sbjct: 1039 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC 1082 >gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] Length = 938 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATK A++GQCGVNC Sbjct: 895 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC 938 >gb|AFZ78556.1| cellulose synthase [Populus tomentosa] Length = 1075 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTSD+TK AA GQCG+NC Sbjct: 1032 RTPTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1075 >ref|XP_002308657.1| cellulose synthase family protein [Populus trichocarpa] gi|222854633|gb|EEE92180.1| cellulose synthase family protein [Populus trichocarpa] Length = 1075 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTSD+TK AA GQCG+NC Sbjct: 1032 RTPTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1075 >gb|AAO25536.1| cellulose synthase [Populus tremuloides] Length = 1083 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTSD+TK AA GQCG+NC Sbjct: 1040 RTPTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1083 >gb|AFB18635.1| CESA6 [Gossypium hirsutum] Length = 1083 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTS+ATK AA GQCG+NC Sbjct: 1040 RTPTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC 1083 >gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium hirsutum] Length = 657 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTS+ATK AA GQCG+NC Sbjct: 614 RTPTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC 657 >ref|XP_007221583.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica] gi|462418519|gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica] Length = 1072 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFT+DATK A+ GQCGVNC Sbjct: 1029 RTPTIVIVWSILLASIFSLLWVRIDPFTNDATKAASNGQCGVNC 1072 >ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] gi|223545480|gb|EEF46985.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] Length = 1083 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTSDA K AA GQCG+NC Sbjct: 1040 RTPTIVIVWSILLASIFSLLWVRIDPFTSDAAKAAANGQCGINC 1083 >ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Solanum tuberosum] Length = 1086 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVW++LLASIFSLLWVRIDPFTSDA+K AA+GQCG+NC Sbjct: 1043 RTPTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 1086 >ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Solanum lycopersicum] Length = 1086 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVW++LLASIFSLLWVRIDPFTSDA+K AA+GQCG+NC Sbjct: 1043 RTPTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 1086 >gb|AAP97497.1| cellulose synthase [Solanum tuberosum] Length = 771 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVW++LLASIFSLLWVRIDPFTSDA+K AA+GQCG+NC Sbjct: 728 RTPTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 771 >ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like isoform X1 [Citrus sinensis] Length = 1102 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVR+DPFTSD TK + GQCG+NC Sbjct: 1059 RTPTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC 1102 >ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citrus clementina] gi|568859626|ref|XP_006483338.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like isoform X2 [Citrus sinensis] gi|557553695|gb|ESR63709.1| hypothetical protein CICLE_v10007296mg [Citrus clementina] Length = 1085 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVR+DPFTSD TK + GQCG+NC Sbjct: 1042 RTPTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC 1085 >gb|AAT66940.1| CesA1 [Acacia mangium] Length = 1082 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFT+D +K ++ GQCGVNC Sbjct: 1039 RTPTIVIVWSILLASIFSLLWVRIDPFTADTSKASSNGQCGVNC 1082 >ref|XP_002324291.1| TGACG-motif binding family protein [Populus trichocarpa] gi|222865725|gb|EEF02856.1| TGACG-motif binding family protein [Populus trichocarpa] Length = 1084 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTS T+ A+ GQCGVNC Sbjct: 1041 RTPTIVIVWSILLASIFSLLWVRIDPFTSGTTQTASNGQCGVNC 1084 >gb|AFZ78558.1| cellulose synthase [Populus tomentosa] Length = 1084 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +3 Query: 3 RTPTIVIVWSILLASIFSLLWVRIDPFTSDATKRAAQGQCGVNC 134 RTPTIVIVWSILLASIFSLLWVRIDPFTS T+ A GQCG+NC Sbjct: 1041 RTPTIVIVWSILLASIFSLLWVRIDPFTSSTTQTTANGQCGINC 1084