BLASTX nr result
ID: Mentha22_contig00038172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00038172 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34959.1| hypothetical protein MIMGU_mgv1a001816mg [Mimulus... 66 6e-09 >gb|EYU34959.1| hypothetical protein MIMGU_mgv1a001816mg [Mimulus guttatus] Length = 755 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 167 MTSIKDWVFSQVISKSVGATRPLSTSESFLSQESQNE 277 MTSIKDWVFSQVIS S+G+TRPLS S+SFLSQE QNE Sbjct: 1 MTSIKDWVFSQVISNSIGSTRPLSASDSFLSQEPQNE 37