BLASTX nr result
ID: Mentha22_contig00037845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00037845 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27866.1| hypothetical protein MIMGU_mgv1a011452mg [Mimulus... 67 3e-09 ref|XP_004232765.1| PREDICTED: U-box domain-containing protein 8... 57 3e-06 >gb|EYU27866.1| hypothetical protein MIMGU_mgv1a011452mg [Mimulus guttatus] Length = 281 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 424 ALREGLFETCVGLLEDDNEKVRRNAKMLIQVLQGKRRNV 308 A+REG+FETCVGLLEDDNEKVRRNAK LIQV+Q +R NV Sbjct: 243 AVREGVFETCVGLLEDDNEKVRRNAKNLIQVIQERRGNV 281 >ref|XP_004232765.1| PREDICTED: U-box domain-containing protein 8-like [Solanum lycopersicum] Length = 371 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 424 ALREGLFETCVGLLEDDNEKVRRNAKMLIQVLQGK 320 A+REG+FE VGLL+DDNEKVRRNA LIQVLQG+ Sbjct: 333 AVREGVFEISVGLLQDDNEKVRRNANSLIQVLQGQ 367