BLASTX nr result
ID: Mentha22_contig00037798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00037798 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17414.1| hypothetical protein MIMGU_mgv1a001764mg [Mimulus... 69 5e-10 gb|EPS64429.1| hypothetical protein M569_10353, partial [Genlise... 59 9e-07 gb|EYU23832.1| hypothetical protein MIMGU_mgv1a003868mg [Mimulus... 55 8e-06 >gb|EYU17414.1| hypothetical protein MIMGU_mgv1a001764mg [Mimulus guttatus] Length = 762 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = -2 Query: 312 YKNEKPLCKFFAAGKCSRDNCRFSHEDPNLNNLEGRL-DKVTESQS-SYDKKWWNAQKWD 139 YK+ KPLCK+FAAGKC +DNC FSHE+PNL+ +E R VTES+S Y ++ WD Sbjct: 92 YKSVKPLCKYFAAGKCGKDNCWFSHENPNLDKVEARRGGDVTESRSPRYKSNRRSSPTWD 151 Query: 138 D 136 D Sbjct: 152 D 152 >gb|EPS64429.1| hypothetical protein M569_10353, partial [Genlisea aurea] Length = 79 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -2 Query: 312 YKNEKPLCKFFAAGKCSRDNCRFSHEDP 229 YK+ KPLCKFFA GKCSRD+CRFSH+DP Sbjct: 48 YKDAKPLCKFFAIGKCSRDDCRFSHDDP 75 >gb|EYU23832.1| hypothetical protein MIMGU_mgv1a003868mg [Mimulus guttatus] Length = 559 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -2 Query: 309 KNEKPLCKFFAAGKCSRDNCRFSHEDPNLNNLEGR 205 KN KP+CK+FAAG C RDNCRFSHE P E R Sbjct: 187 KNGKPVCKYFAAGNCDRDNCRFSHEGPKPKGQEDR 221