BLASTX nr result
ID: Mentha22_contig00037741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00037741 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36693.1| hypothetical protein MIMGU_mgv1a014878mg [Mimulus... 59 7e-07 >gb|EYU36693.1| hypothetical protein MIMGU_mgv1a014878mg [Mimulus guttatus] Length = 175 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -2 Query: 112 R*KMMQHKRGPISLEQSNLMDIMPKRLKTEEPLSSKE 2 R +MMQHKRGPISLEQ++ D+MPKRLKT+ PLS+KE Sbjct: 24 RREMMQHKRGPISLEQNSFTDLMPKRLKTDVPLSTKE 60