BLASTX nr result
ID: Mentha22_contig00037707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00037707 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34101.1| hypothetical protein MIMGU_mgv1a003748mg [Mimulus... 75 9e-12 >gb|EYU34101.1| hypothetical protein MIMGU_mgv1a003748mg [Mimulus guttatus] gi|604328543|gb|EYU34102.1| hypothetical protein MIMGU_mgv1a003748mg [Mimulus guttatus] Length = 566 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 323 MGKSAGKWIKTVLFGKKHSKSNYSKNVTPDKKSAVKTPNED 445 MGKSAGKWIKTVLFGKK+SKSN+SKNVTPDK++ KTP ED Sbjct: 1 MGKSAGKWIKTVLFGKKYSKSNFSKNVTPDKRTGQKTPAED 41