BLASTX nr result
ID: Mentha22_contig00037687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00037687 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35615.1| hypothetical protein MIMGU_mgv1a012869mg [Mimulus... 63 4e-08 >gb|EYU35615.1| hypothetical protein MIMGU_mgv1a012869mg [Mimulus guttatus] Length = 237 Score = 63.2 bits (152), Expect = 4e-08 Identities = 39/76 (51%), Positives = 46/76 (60%), Gaps = 4/76 (5%) Frame = -3 Query: 220 ISISPRNYPTSKKHY-AEGEAKLPISTMFXXXXXXS---NQTPAPHFLSEKRPLRLSSTP 53 ISIS RNY +K+ EAKLP S++F S QT F + R +SSTP Sbjct: 11 ISISSRNYSNLRKNKNGANEAKLPSSSLFCSSSSLSLSSKQTTTLQFFNNNRAPPISSTP 70 Query: 52 RTLTVIAMAPPKPGGK 5 RTLTVI+MAPPKPGGK Sbjct: 71 RTLTVISMAPPKPGGK 86