BLASTX nr result
ID: Mentha22_contig00037547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00037547 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67684.1| hypothetical protein M569_07090, partial [Genlise... 73 4e-11 >gb|EPS67684.1| hypothetical protein M569_07090, partial [Genlisea aurea] Length = 205 Score = 73.2 bits (178), Expect = 4e-11 Identities = 43/83 (51%), Positives = 58/83 (69%) Frame = -1 Query: 250 KQNQGLIVKGSIHSRHSKVFCNAASLEEEFSAIQSKSFSKDEESLDSETLPEETTVERLP 71 K N LI + S + R +V C ++LEEEF+A+QSK F K+ S D + EE T +LP Sbjct: 26 KSNGILIGRSSANHRRWRVLCKPSNLEEEFAALQSKKFFKNVNS-DPDDSSEEAT-PKLP 83 Query: 70 TSEELKALLADSQRTTLVEKLSE 2 +SEELKALLADS+R+ L++KLSE Sbjct: 84 SSEELKALLADSERSKLLKKLSE 106