BLASTX nr result
ID: Mentha22_contig00036547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00036547 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18963.1| hypothetical protein MIMGU_mgv1a024462mg [Mimulus... 60 3e-07 >gb|EYU18963.1| hypothetical protein MIMGU_mgv1a024462mg [Mimulus guttatus] Length = 573 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/72 (44%), Positives = 41/72 (56%) Frame = +3 Query: 132 DEFHSNKQSGCMWGLVHVLDYHQWQSNVKKIIPHRKYNGPSPLQLFAGEWSPDTSVHGRD 311 D +KQ GCM GLVHVLDYH W SNV+K+I HRKY+ H RD Sbjct: 11 DSQSQDKQPGCMSGLVHVLDYHLWHSNVRKMIRHRKYD----------------ETHNRD 54 Query: 312 GYEKLIDEEKSP 347 E+L++E ++P Sbjct: 55 A-EQLLEEIETP 65