BLASTX nr result
ID: Mentha22_contig00036220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00036220 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27789.1| hypothetical protein MIMGU_mgv1a003034mg [Mimulus... 74 3e-11 >gb|EYU27789.1| hypothetical protein MIMGU_mgv1a003034mg [Mimulus guttatus] Length = 613 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -2 Query: 187 MFVSLFASRRRNLLVRGLHFIKKFISPGAENIIFKAICVNISQRKW 50 MF+ LF+S+RRNL VRGLHF KKF +P AE+I+FKA+CVNI Q+KW Sbjct: 1 MFLGLFSSKRRNLFVRGLHFGKKFTTPTAEDIVFKAVCVNIRQKKW 46