BLASTX nr result
ID: Mentha22_contig00036105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00036105 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18110.1| hypothetical protein MIMGU_mgv1a000049mg [Mimulus... 64 3e-08 >gb|EYU18110.1| hypothetical protein MIMGU_mgv1a000049mg [Mimulus guttatus] Length = 2108 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 383 INLPASHSMHTSYPPQS-MQPILFRPGSMPVNLYVNSLIPHHGEN 252 +N AS SM SYPP M P+LFRP SMPVNLY N+L+PHHG+N Sbjct: 1903 VNPSASRSMQNSYPPTHLMPPLLFRPNSMPVNLYGNNLVPHHGDN 1947