BLASTX nr result
ID: Mentha22_contig00035132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035132 (729 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44770.1| hypothetical protein MIMGU_mgv1a007476mg [Mimulus... 80 5e-19 ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransf... 82 2e-13 emb|CAN74291.1| hypothetical protein VITISV_015980 [Vitis vinifera] 82 2e-13 ref|XP_006364000.1| PREDICTED: anthranilate phosphoribosyltransf... 74 5e-11 ref|XP_002318059.2| hypothetical protein POPTR_0012s08440g [Popu... 71 3e-10 ref|XP_004252211.1| PREDICTED: anthranilate phosphoribosyltransf... 71 4e-10 ref|XP_007036259.1| Tryptophan biosynthesis 1 [Theobroma cacao] ... 70 6e-10 ref|XP_002511378.1| anthranilate phosphoribosyltransferase, puta... 70 1e-09 ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransf... 69 1e-09 gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidops... 68 3e-09 ref|XP_002871793.1| hypothetical protein ARALYDRAFT_909800 [Arab... 68 3e-09 ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabido... 68 4e-09 ref|XP_002880727.1| hypothetical protein ARALYDRAFT_901281 [Arab... 68 4e-09 ref|XP_002878960.1| hypothetical protein ARALYDRAFT_901396 [Arab... 68 4e-09 ref|XP_004298957.1| PREDICTED: anthranilate phosphoribosyltransf... 67 5e-09 ref|XP_006400342.1| hypothetical protein EUTSA_v10013530mg [Eutr... 67 6e-09 ref|XP_006400341.1| hypothetical protein EUTSA_v10013530mg [Eutr... 67 6e-09 ref|XP_006840664.1| hypothetical protein AMTR_s00096p00025660 [A... 67 8e-09 ref|XP_006287763.1| hypothetical protein CARUB_v10000975mg [Caps... 67 8e-09 ref|XP_004173893.1| PREDICTED: anthranilate phosphoribosyltransf... 66 1e-08 >gb|EYU44770.1| hypothetical protein MIMGU_mgv1a007476mg [Mimulus guttatus] Length = 406 Score = 80.5 bits (197), Expect(2) = 5e-19 Identities = 40/49 (81%), Positives = 47/49 (95%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +LMECLLNKEDLSEEEAEGSL+FLL++ + +LISA+LVLLRAKGETFEE Sbjct: 66 ELMECLLNKEDLSEEEAEGSLDFLLSDCSQSLISAYLVLLRAKGETFEE 114 Score = 40.8 bits (94), Expect(2) = 5e-19 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = -2 Query: 452 MAVLRQNSLFSS-PFHLTSKKCKHSSEILRQPAFDPVRQSQFLRRSCPGIELHRPPLRLP 276 M VL +N + SS PFH KK S ++ + P+++ L +S + RPPL LP Sbjct: 1 MDVLMKNVIVSSSPFHPIFKKSNFSHQVQNFSSLTPIKRHSILTKSFLQTDSCRPPLHLP 60 Query: 275 ISCPKEV 255 I P E+ Sbjct: 61 IFSPMEL 67 >ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|296087637|emb|CBI34893.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+ECLLN+ED SEEEAE SLNFLL +G++ALISAFLVLLRAKGETFEE Sbjct: 66 QLLECLLNREDFSEEEAEESLNFLLNDGSEALISAFLVLLRAKGETFEE 114 >emb|CAN74291.1| hypothetical protein VITISV_015980 [Vitis vinifera] Length = 830 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+ECLLN+ED SEEEAE SLNFLL +G++ALISAFLVLLRAKGETFEE Sbjct: 458 QLLECLLNREDFSEEEAEESLNFLLNDGSEALISAFLVLLRAKGETFEE 506 >ref|XP_006364000.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Solanum tuberosum] Length = 384 Score = 73.9 bits (180), Expect = 5e-11 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +LME LLNKEDL+E EAE SL+FLL +G++ALISAFLVLLRAKGETF E Sbjct: 50 QLMERLLNKEDLNEAEAEASLDFLLKDGSEALISAFLVLLRAKGETFRE 98 >ref|XP_002318059.2| hypothetical protein POPTR_0012s08440g [Populus trichocarpa] gi|550326665|gb|EEE96279.2| hypothetical protein POPTR_0012s08440g [Populus trichocarpa] Length = 420 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEEA 10 +L+E L+NK DLSE EAE SL++LL + ++ALISAFLVLLRAKGETFEEA Sbjct: 80 ELIESLINKVDLSESEAEASLDYLLDDASEALISAFLVLLRAKGETFEEA 129 >ref|XP_004252211.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Solanum lycopersicum] Length = 386 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +LME LL KEDL+E EAE SL+F+L +G++ALISAFLVLLRAKGETF E Sbjct: 52 QLMERLLKKEDLNEAEAEASLDFMLKDGSEALISAFLVLLRAKGETFRE 100 >ref|XP_007036259.1| Tryptophan biosynthesis 1 [Theobroma cacao] gi|508773504|gb|EOY20760.1| Tryptophan biosynthesis 1 [Theobroma cacao] Length = 424 Score = 70.5 bits (171), Expect = 6e-10 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+N+ DL+E EAE SL+FLL N+ALISAFLVLLRAKGETFEE Sbjct: 80 ELIESLINRVDLTESEAEASLDFLLAEANEALISAFLVLLRAKGETFEE 128 >ref|XP_002511378.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] gi|223550493|gb|EEF51980.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] Length = 425 Score = 69.7 bits (169), Expect = 1e-09 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEEATL 4 +L+E L+N+ DLSE EAE SL++LL + N+ALISAFLVLLRAKGETFEE + Sbjct: 88 ELIESLINRVDLSESEAEASLDYLLDDVNEALISAFLVLLRAKGETFEEVNV 139 >ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|297733759|emb|CBI15006.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 KL+E L+++ DL+E EAE SL+FLL+ N+ALISAFLVLLRAKGET+EE Sbjct: 57 KLIESLISRVDLTESEAEASLDFLLSEANEALISAFLVLLRAKGETYEE 105 >gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|28394222|gb|AAO42464.1| phosphorybosyl anthranilate transferase 1 [Arabidopsis thaliana] Length = 441 Score = 68.2 bits (165), Expect = 3e-09 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+++ DLSE EAE SL FLL N+ALISAFLVLLRAKGET+EE Sbjct: 107 QLIETLIDRVDLSESEAESSLEFLLNEANEALISAFLVLLRAKGETYEE 155 >ref|XP_002871793.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. lyrata] gi|297317630|gb|EFH48052.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. lyrata] Length = 444 Score = 68.2 bits (165), Expect = 3e-09 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+++ DLSE EAE SL FLL N+ALISAFLVLLRAKGET+EE Sbjct: 110 QLIETLIDRVDLSESEAESSLEFLLNEANEALISAFLVLLRAKGETYEE 158 >ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana] gi|401213|sp|Q02166.1|TRPD_ARATH RecName: Full=Anthranilate phosphoribosyltransferase, chloroplastic; Flags: Precursor gi|166792|gb|AAA32835.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|9757891|dbj|BAB08398.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|15450852|gb|AAK96697.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|20259900|gb|AAM13297.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|332005110|gb|AED92493.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana] gi|445600|prf||1909347A phosphoribosylanthranilate transferase Length = 444 Score = 67.8 bits (164), Expect = 4e-09 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+++ DLSE EAE SL FLL N+ALISAFLVLLRAKGET+EE Sbjct: 110 QLIETLIDRVDLSETEAESSLEFLLNEANEALISAFLVLLRAKGETYEE 158 >ref|XP_002880727.1| hypothetical protein ARALYDRAFT_901281 [Arabidopsis lyrata subsp. lyrata] gi|297326566|gb|EFH56986.1| hypothetical protein ARALYDRAFT_901281 [Arabidopsis lyrata subsp. lyrata] Length = 262 Score = 67.8 bits (164), Expect = 4e-09 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+++ DLSE EAE SL FLL N+ALISAFLVLLRAKGET+EE Sbjct: 113 QLIETLIDRVDLSEAEAESSLEFLLNEANEALISAFLVLLRAKGETYEE 161 >ref|XP_002878960.1| hypothetical protein ARALYDRAFT_901396 [Arabidopsis lyrata subsp. lyrata] gi|297324799|gb|EFH55219.1| hypothetical protein ARALYDRAFT_901396 [Arabidopsis lyrata subsp. lyrata] Length = 306 Score = 67.8 bits (164), Expect = 4e-09 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+++ DLSE EAE SL FLL N+ALISAFLVLLRAKGET+EE Sbjct: 157 QLIETLIDRVDLSEAEAESSLEFLLNEANEALISAFLVLLRAKGETYEE 205 >ref|XP_004298957.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 404 Score = 67.4 bits (163), Expect = 5e-09 Identities = 32/49 (65%), Positives = 44/49 (89%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L++K+DLSE E+E ++ FLL++ N+ALISAFLVLLRAKGET+EE Sbjct: 67 ELIESLIDKKDLSESESEAAMEFLLSDTNEALISAFLVLLRAKGETYEE 115 >ref|XP_006400342.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum] gi|557101432|gb|ESQ41795.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum] Length = 448 Score = 67.0 bits (162), Expect = 6e-09 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+++ DLSE E E SL FLL N+ALISAFLVLLRAKGET+EE Sbjct: 114 QLIEALIDRVDLSESETESSLEFLLNEANEALISAFLVLLRAKGETYEE 162 >ref|XP_006400341.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum] gi|557101431|gb|ESQ41794.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum] Length = 372 Score = 67.0 bits (162), Expect = 6e-09 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+++ DLSE E E SL FLL N+ALISAFLVLLRAKGET+EE Sbjct: 114 QLIEALIDRVDLSESETESSLEFLLNEANEALISAFLVLLRAKGETYEE 162 >ref|XP_006840664.1| hypothetical protein AMTR_s00096p00025660 [Amborella trichopoda] gi|548842409|gb|ERN02339.1| hypothetical protein AMTR_s00096p00025660 [Amborella trichopoda] Length = 423 Score = 66.6 bits (161), Expect = 8e-09 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEEAT 7 +++E L+ EDLS+EEAE +L++LL+ N+A ISAFLVLLRAKGET+EE T Sbjct: 85 EVLESLIEMEDLSKEEAEAALDYLLSEANEAQISAFLVLLRAKGETYEEIT 135 >ref|XP_006287763.1| hypothetical protein CARUB_v10000975mg [Capsella rubella] gi|482556469|gb|EOA20661.1| hypothetical protein CARUB_v10000975mg [Capsella rubella] Length = 441 Score = 66.6 bits (161), Expect = 8e-09 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -1 Query: 159 KLMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 +L+E L+++ DLSE EAE SL FLL N+ LISAFLVLLRAKGET+EE Sbjct: 107 QLIETLIDRVDLSESEAESSLEFLLNEANEVLISAFLVLLRAKGETYEE 155 >ref|XP_004173893.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like, partial [Cucumis sativus] Length = 212 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -1 Query: 156 LMECLLNKEDLSEEEAEGSLNFLLTNGNDALISAFLVLLRAKGETFEE 13 L+E L+N+ DLSE+EAE SL +LL + ++A ISAFLVLLRAKGET+EE Sbjct: 83 LIESLINRVDLSEDEAEASLQYLLNDASEAAISAFLVLLRAKGETYEE 130