BLASTX nr result
ID: Mentha22_contig00035119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035119 (725 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006672882.1| SRF-type transcription factor RlmA [Cordycep... 58 4e-06 >ref|XP_006672882.1| SRF-type transcription factor RlmA [Cordyceps militaris CM01] gi|346319826|gb|EGX89427.1| SRF-type transcription factor RlmA [Cordyceps militaris CM01] Length = 943 Score = 57.8 bits (138), Expect = 4e-06 Identities = 32/101 (31%), Positives = 44/101 (43%) Frame = +3 Query: 6 HQGQNYNSQPEFNQTHSQYPNHPHQNPQYAHHAGSPPSMHDQSSGYTGYSPQLSGQFNQA 185 H Q+++ Q Q HSQ P+H +PQ +H S P + GY+PQ Q QA Sbjct: 517 HSQQSHSQQSHSQQPHSQQPHHQQSHPQQSHSQQSHPQQPHAQQPHPGYTPQPPPQQTQA 576 Query: 186 PYPHQNDRQNLSFPQDSHAHYNPSHEQHIPSHEPYGQHSSP 308 P+P Q Q +S P P+ H P + S P Sbjct: 577 PFPPQPSSQAMSMPPRPDIQ-QPTTMPHPPPPDRRPMESQP 616