BLASTX nr result
ID: Mentha22_contig00034900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00034900 (499 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37841.1| hypothetical protein MIMGU_mgv1a011874mg [Mimulus... 81 2e-13 gb|EXC24662.1| hypothetical protein L484_008433 [Morus notabilis] 57 3e-06 >gb|EYU37841.1| hypothetical protein MIMGU_mgv1a011874mg [Mimulus guttatus] Length = 268 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +3 Query: 18 TSLNPIRENESRLPHGEQASDSTSSISEYLMETLPGWHVDDLLDPSSHYGF 170 +S NP+ NES EQ SDSTSSISEYLMETLPGWHV+DLLDPS+HYGF Sbjct: 216 SSSNPMGYNESNQVMSEQQSDSTSSISEYLMETLPGWHVEDLLDPSTHYGF 266 >gb|EXC24662.1| hypothetical protein L484_008433 [Morus notabilis] Length = 299 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +3 Query: 24 LNPIRENESRLPHGEQASDSTSSISEYLMETLPGWHVDDLLDPS 155 +NP+ N + AS STSSISEYLMETLPGWHV+D LDPS Sbjct: 154 INPVPSNT------DNASYSTSSISEYLMETLPGWHVEDFLDPS 191