BLASTX nr result
ID: Mentha22_contig00034701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00034701 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68544.1| hypothetical protein M569_06219, partial [Genlise... 57 3e-06 ref|XP_002520139.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >gb|EPS68544.1| hypothetical protein M569_06219, partial [Genlisea aurea] Length = 798 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 411 DSLQVEVRAKGLTYVPEQSLKINATSSIATGIL 313 DSLQ+EV+ KG+ YVPEQSLKI+ATSSIATGIL Sbjct: 766 DSLQIEVKEKGIAYVPEQSLKIHATSSIATGIL 798 >ref|XP_002520139.1| conserved hypothetical protein [Ricinus communis] gi|223540631|gb|EEF42194.1| conserved hypothetical protein [Ricinus communis] Length = 843 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 411 DSLQVEVRAKGLTYVPEQSLKINATSSIATGIL 313 DSLQ++V+ KGLTY+PE SLKINATSSI+TGI+ Sbjct: 811 DSLQIDVKDKGLTYIPEHSLKINATSSISTGII 843