BLASTX nr result
ID: Mentha22_contig00034217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00034217 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004288359.1| PREDICTED: two-pore potassium channel 5-like... 60 3e-07 ref|XP_007051279.1| Ca2+ activated outward rectifying K+ channel... 59 9e-07 gb|EYU46878.1| hypothetical protein MIMGU_mgv1a007372mg [Mimulus... 58 2e-06 ref|XP_006355824.1| PREDICTED: two-pore potassium channel 5-like... 57 2e-06 ref|XP_004240644.1| PREDICTED: two-pore potassium channel 5-like... 57 2e-06 ref|XP_007221537.1| hypothetical protein PRUPE_ppa023309mg [Prun... 57 3e-06 ref|XP_002320260.2| hypothetical protein POPTR_0014s10900g [Popu... 56 5e-06 ref|XP_002515189.1| Calcium-activated outward-rectifying potassi... 56 5e-06 ref|XP_002302805.1| calcium-activated outward-rectifying potassi... 56 6e-06 ref|XP_003554573.1| PREDICTED: two-pore potassium channel 5-like... 55 8e-06 ref|XP_003520770.1| PREDICTED: two-pore potassium channel 5-like... 55 8e-06 emb|CBI37064.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002274039.1| PREDICTED: probable calcium-activated outwar... 55 8e-06 emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] 55 8e-06 >ref|XP_004288359.1| PREDICTED: two-pore potassium channel 5-like [Fragaria vesca subsp. vesca] Length = 397 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI EKDI+QICDQFSKLDSN+SGKIT Sbjct: 358 LKEMGKIDEKDIMQICDQFSKLDSNHSGKIT 388 >ref|XP_007051279.1| Ca2+ activated outward rectifying K+ channel 5 [Theobroma cacao] gi|508703540|gb|EOX95436.1| Ca2+ activated outward rectifying K+ channel 5 [Theobroma cacao] Length = 388 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI EKDILQIC+QFSKLD NNSGKIT Sbjct: 349 LKEMGKIGEKDILQICNQFSKLDPNNSGKIT 379 >gb|EYU46878.1| hypothetical protein MIMGU_mgv1a007372mg [Mimulus guttatus] Length = 409 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKIKE DILQIC+QF+KLD NNSGKIT Sbjct: 370 LKEMGKIKETDILQICNQFNKLDPNNSGKIT 400 >ref|XP_006355824.1| PREDICTED: two-pore potassium channel 5-like [Solanum tuberosum] Length = 379 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI EKD++QIC+QF+KLD NNSGKIT Sbjct: 340 LKEMGKISEKDVMQICNQFNKLDENNSGKIT 370 >ref|XP_004240644.1| PREDICTED: two-pore potassium channel 5-like [Solanum lycopersicum] Length = 379 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI EKD++QIC+QF+KLD NNSGKIT Sbjct: 340 LKEMGKINEKDVMQICNQFNKLDENNSGKIT 370 >ref|XP_007221537.1| hypothetical protein PRUPE_ppa023309mg [Prunus persica] gi|462418287|gb|EMJ22736.1| hypothetical protein PRUPE_ppa023309mg [Prunus persica] Length = 376 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI EKDILQIC+QFSKLD N+SGKIT Sbjct: 337 LKEMGKIGEKDILQICNQFSKLDQNHSGKIT 367 >ref|XP_002320260.2| hypothetical protein POPTR_0014s10900g [Populus trichocarpa] gi|550323953|gb|EEE98575.2| hypothetical protein POPTR_0014s10900g [Populus trichocarpa] Length = 357 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI EKDILQIC+QFSKLD NN GKIT Sbjct: 318 LKEMGKIGEKDILQICNQFSKLDPNNLGKIT 348 >ref|XP_002515189.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223545669|gb|EEF47173.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 390 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI EKDILQIC+QFSKLD NN GKIT Sbjct: 351 LKEMGKIGEKDILQICNQFSKLDPNNLGKIT 381 >ref|XP_002302805.1| calcium-activated outward-rectifying potassium channel 5 family protein [Populus trichocarpa] gi|222844531|gb|EEE82078.1| calcium-activated outward-rectifying potassium channel 5 family protein [Populus trichocarpa] Length = 379 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI EKD+LQIC+QFSKLD NN GKIT Sbjct: 340 LKEMGKIGEKDVLQICNQFSKLDPNNLGKIT 370 >ref|XP_003554573.1| PREDICTED: two-pore potassium channel 5-like [Glycine max] Length = 385 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI+EKD+LQICDQF KLD +N GKIT Sbjct: 346 LKEMGKIQEKDVLQICDQFRKLDPSNCGKIT 376 >ref|XP_003520770.1| PREDICTED: two-pore potassium channel 5-like [Glycine max] Length = 376 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI+EKD+LQICDQF KLD +N GKIT Sbjct: 337 LKEMGKIQEKDVLQICDQFRKLDPSNCGKIT 367 >emb|CBI37064.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 176 LKEMGKIAENDVLQICNQFNKLDPNNSGKIT 206 >ref|XP_002274039.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic [Vitis vinifera] Length = 390 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 351 LKEMGKIAENDVLQICNQFNKLDPNNSGKIT 381 >emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] Length = 390 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 439 LKEMGKIKEKDILQICDQFSKLDSNNSGKIT 347 LKEMGKI E D+LQIC+QF+KLD NNSGKIT Sbjct: 351 LKEMGKIAENDVLQICNQFNKLDPNNSGKIT 381