BLASTX nr result
ID: Mentha22_contig00033794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00033794 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205059.1| hypothetical protein PRUPE_ppa004457mg [Prun... 67 3e-09 ref|XP_002323579.1| LMBR1 integral membrane family protein [Popu... 67 3e-09 gb|EYU26666.1| hypothetical protein MIMGU_mgv1a004810mg [Mimulus... 66 4e-09 ref|XP_007140346.1| hypothetical protein PHAVU_008G104400g [Phas... 66 6e-09 ref|XP_004302541.1| PREDICTED: LIMR family protein At5g01460-lik... 66 6e-09 ref|XP_006365594.1| PREDICTED: LIMR family protein At5g01460-lik... 65 8e-09 ref|XP_004506746.1| PREDICTED: LIMR family protein At5g01460-lik... 65 8e-09 ref|XP_004492444.1| PREDICTED: LIMR family protein At5g01460-lik... 65 8e-09 ref|XP_004246766.1| PREDICTED: LIMR family protein At5g01460-lik... 65 8e-09 ref|XP_004148616.1| PREDICTED: LIMR family protein At3g08930-lik... 65 8e-09 ref|XP_003552245.1| PREDICTED: LIMR family protein At5g01460-lik... 65 8e-09 ref|XP_003529151.1| PREDICTED: LIMR family protein At5g01460-lik... 65 8e-09 ref|XP_002308217.1| LMBR1 integral membrane family protein [Popu... 65 8e-09 ref|XP_007026707.1| LMBR1-like membrane protein isoform 3 [Theob... 65 1e-08 ref|XP_007026705.1| LMBR1-like membrane protein isoform 1 [Theob... 65 1e-08 ref|XP_003520496.1| PREDICTED: LIMR family protein At3g08930-lik... 65 1e-08 ref|XP_002280330.1| PREDICTED: LIMR family protein At5g01460 [Vi... 65 1e-08 ref|NP_566338.2| LMBR1-like membrane protein [Arabidopsis thalia... 65 1e-08 ref|XP_006429390.1| hypothetical protein CICLE_v10011517mg [Citr... 64 2e-08 ref|XP_007133897.1| hypothetical protein PHAVU_010G001200g [Phas... 64 2e-08 >ref|XP_007205059.1| hypothetical protein PRUPE_ppa004457mg [Prunus persica] gi|462400701|gb|EMJ06258.1| hypothetical protein PRUPE_ppa004457mg [Prunus persica] Length = 508 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAFI+LAGLTFVYYAAFGWRRKK +GR QLSS Sbjct: 474 VFQIAFIVLAGLTFVYYAAFGWRRKKPSGRFQLSS 508 >ref|XP_002323579.1| LMBR1 integral membrane family protein [Populus trichocarpa] gi|222868209|gb|EEF05340.1| LMBR1 integral membrane family protein [Populus trichocarpa] Length = 509 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF++LAGLTFVYYAAFGWRRKK +GR QLSS Sbjct: 475 VFQIAFVVLAGLTFVYYAAFGWRRKKPSGRFQLSS 509 >gb|EYU26666.1| hypothetical protein MIMGU_mgv1a004810mg [Mimulus guttatus] Length = 509 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQI FIILAGLTFVYYAAFGWRRKKT GR QLS+ Sbjct: 475 VFQIGFIILAGLTFVYYAAFGWRRKKTRGRFQLST 509 >ref|XP_007140346.1| hypothetical protein PHAVU_008G104400g [Phaseolus vulgaris] gi|561013479|gb|ESW12340.1| hypothetical protein PHAVU_008G104400g [Phaseolus vulgaris] Length = 509 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF+ILAGLTFVYYAAFGWRRKK +GR QLS+ Sbjct: 475 VFQIAFVILAGLTFVYYAAFGWRRKKPSGRFQLST 509 >ref|XP_004302541.1| PREDICTED: LIMR family protein At5g01460-like [Fragaria vesca subsp. vesca] Length = 508 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQI FIILAGLTFVYYAAFGWRRKK +GR QLSS Sbjct: 474 VFQIGFIILAGLTFVYYAAFGWRRKKPSGRFQLSS 508 >ref|XP_006365594.1| PREDICTED: LIMR family protein At5g01460-like [Solanum tuberosum] Length = 509 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQI FI+LAGLTFVYYAAFGWRRKK +GR QLSS Sbjct: 475 VFQIGFIVLAGLTFVYYAAFGWRRKKPSGRFQLSS 509 >ref|XP_004506746.1| PREDICTED: LIMR family protein At5g01460-like [Cicer arietinum] Length = 509 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF++LAGLTFVYYAAFGWRRKK +GR QLS+ Sbjct: 475 VFQIAFVVLAGLTFVYYAAFGWRRKKPSGRFQLST 509 >ref|XP_004492444.1| PREDICTED: LIMR family protein At5g01460-like [Cicer arietinum] Length = 509 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF++LAGLTFVYYAAFGWRRKK +GR QLS+ Sbjct: 475 VFQIAFVVLAGLTFVYYAAFGWRRKKPSGRFQLST 509 >ref|XP_004246766.1| PREDICTED: LIMR family protein At5g01460-like [Solanum lycopersicum] Length = 509 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQI FI+LAGLTFVYYAAFGWRRKK +GR QLSS Sbjct: 475 VFQIGFIVLAGLTFVYYAAFGWRRKKPSGRFQLSS 509 >ref|XP_004148616.1| PREDICTED: LIMR family protein At3g08930-like [Cucumis sativus] gi|449522716|ref|XP_004168372.1| PREDICTED: LIMR family protein At3g08930-like [Cucumis sativus] Length = 509 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAFI LAGLTFVYYAAFGWRRKK +GR QLSS Sbjct: 475 VFQIAFIALAGLTFVYYAAFGWRRKKLSGRFQLSS 509 >ref|XP_003552245.1| PREDICTED: LIMR family protein At5g01460-like [Glycine max] Length = 509 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF++LAGLTFVYYAAFGWRRKK +GR QLS+ Sbjct: 475 VFQIAFVVLAGLTFVYYAAFGWRRKKPSGRFQLST 509 >ref|XP_003529151.1| PREDICTED: LIMR family protein At5g01460-like [Glycine max] Length = 509 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF++LAGLTFVYYAAFGWRRKK +GR QLS+ Sbjct: 475 VFQIAFVVLAGLTFVYYAAFGWRRKKPSGRFQLST 509 >ref|XP_002308217.1| LMBR1 integral membrane family protein [Populus trichocarpa] gi|222854193|gb|EEE91740.1| LMBR1 integral membrane family protein [Populus trichocarpa] Length = 509 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQI+F++LAGLTFVYYAAFGWRRKK +GR QLSS Sbjct: 475 VFQISFVVLAGLTFVYYAAFGWRRKKRSGRFQLSS 509 >ref|XP_007026707.1| LMBR1-like membrane protein isoform 3 [Theobroma cacao] gi|508715312|gb|EOY07209.1| LMBR1-like membrane protein isoform 3 [Theobroma cacao] Length = 354 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF++LAGLTFVYY AFGWRRKK +GR QLSS Sbjct: 320 VFQIAFVVLAGLTFVYYVAFGWRRKKPSGRFQLSS 354 >ref|XP_007026705.1| LMBR1-like membrane protein isoform 1 [Theobroma cacao] gi|508715310|gb|EOY07207.1| LMBR1-like membrane protein isoform 1 [Theobroma cacao] Length = 510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF++LAGLTFVYY AFGWRRKK +GR QLSS Sbjct: 476 VFQIAFVVLAGLTFVYYVAFGWRRKKPSGRFQLSS 510 >ref|XP_003520496.1| PREDICTED: LIMR family protein At3g08930-like [Glycine max] Length = 508 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF+ LAGLTFVYYAAFGWRRKK +GR QLSS Sbjct: 474 VFQIAFVALAGLTFVYYAAFGWRRKKPSGRFQLSS 508 >ref|XP_002280330.1| PREDICTED: LIMR family protein At5g01460 [Vitis vinifera] gi|297740207|emb|CBI30389.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAFI+LAGLTFVYYAAFGWRR++ +GR QLSS Sbjct: 475 VFQIAFIVLAGLTFVYYAAFGWRRRRPSGRFQLSS 509 >ref|NP_566338.2| LMBR1-like membrane protein [Arabidopsis thaliana] gi|226789815|sp|Q9SR93.2|LMBD1_ARATH RecName: Full=LIMR family protein At3g08930 gi|14334836|gb|AAK59596.1| unknown protein [Arabidopsis thaliana] gi|24417362|gb|AAN60291.1| unknown [Arabidopsis thaliana] gi|56550703|gb|AAV97805.1| At3g08930 [Arabidopsis thaliana] gi|332641175|gb|AEE74696.1| LMBR1-like membrane protein [Arabidopsis thaliana] Length = 509 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQI F+ILAGLTF+YY AFGWRRKKT+GR QLSS Sbjct: 475 VFQIGFVILAGLTFLYYIAFGWRRKKTSGRFQLSS 509 >ref|XP_006429390.1| hypothetical protein CICLE_v10011517mg [Citrus clementina] gi|568854868|ref|XP_006481038.1| PREDICTED: LIMR family protein At5g01460-like [Citrus sinensis] gi|557531447|gb|ESR42630.1| hypothetical protein CICLE_v10011517mg [Citrus clementina] Length = 510 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF++LAGLTFVYYAAFGWRR+K +G+ QLSS Sbjct: 476 VFQIAFVVLAGLTFVYYAAFGWRRRKPSGKFQLSS 510 >ref|XP_007133897.1| hypothetical protein PHAVU_010G001200g [Phaseolus vulgaris] gi|561006942|gb|ESW05891.1| hypothetical protein PHAVU_010G001200g [Phaseolus vulgaris] Length = 508 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 456 VFQIAFIILAGLTFVYYAAFGWRRKKTTGRLQLSS 352 VFQIAF+ LAGLTFVYYAAFGWRRKK +GR QLS+ Sbjct: 474 VFQIAFVALAGLTFVYYAAFGWRRKKPSGRFQLST 508