BLASTX nr result
ID: Mentha22_contig00033697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00033697 (507 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33386.1| hypothetical protein MIMGU_mgv1a005762mg [Mimulus... 80 3e-13 >gb|EYU33386.1| hypothetical protein MIMGU_mgv1a005762mg [Mimulus guttatus] Length = 471 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/59 (67%), Positives = 47/59 (79%), Gaps = 4/59 (6%) Frame = +3 Query: 3 QRYSDGSAPSFFLGTAEP---HHQFLPGFDSRG-FQLCYGDAAHANNGRNSAKRGKGKN 167 QR+SDGS PSFF+ TA P HHQFL G+D+ G QLCYGDA HANNGR+S ++GKGKN Sbjct: 414 QRFSDGSPPSFFVSTAAPVENHHQFLSGYDAAGRLQLCYGDA-HANNGRHSGQKGKGKN 471