BLASTX nr result
ID: Mentha22_contig00033220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00033220 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACB45089.1| putative polyprotein [Solanum habrochaites] 56 6e-06 >gb|ACB45089.1| putative polyprotein [Solanum habrochaites] Length = 849 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/81 (35%), Positives = 39/81 (48%) Frame = -2 Query: 246 KPPVWMRDFVGTIDTTALPDIVQGITPPTFPYLIGPGLSSPYVEYLLNISLHK*PFSYKE 67 KPP W+ DFV + + P Y+ +S+PY + L N S P SY E Sbjct: 622 KPPGWLHDFVHIATHSPTSSLTCSTAHPLSSYMSYSSISTPYFQSLCNFSAIPEPTSYNE 681 Query: 66 ASTIPHWVEAMDAELLALDKN 4 A HW++AM+ EL AL N Sbjct: 682 AVQHSHWIQAMELELKALHDN 702