BLASTX nr result
ID: Mentha22_contig00033161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00033161 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007163414.1| hypothetical protein PHAVU_001G232700g [Phas... 59 9e-07 gb|AAN39330.1| telomere binding protein TBP1 [Nicotiana glutinosa] 58 1e-06 gb|EYU19914.1| hypothetical protein MIMGU_mgv1a002489mg [Mimulus... 57 2e-06 emb|CAC19789.1| MYB-like DNA-binding protein [Catharanthus roseus] 55 8e-06 >ref|XP_007163414.1| hypothetical protein PHAVU_001G232700g [Phaseolus vulgaris] gi|561036878|gb|ESW35408.1| hypothetical protein PHAVU_001G232700g [Phaseolus vulgaris] Length = 680 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -1 Query: 99 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGP 7 MV KKR+DYGFNG+R P+IP+APRS+R+RGP Sbjct: 1 MVLKKRIDYGFNGFRVPIIPKAPRSVRRRGP 31 >gb|AAN39330.1| telomere binding protein TBP1 [Nicotiana glutinosa] Length = 681 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 99 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCK 1 MVSKK+LD+GFNG++ P IP+APRS+R+RG CK Sbjct: 1 MVSKKKLDFGFNGFQVPFIPKAPRSVRRRGTCK 33 >gb|EYU19914.1| hypothetical protein MIMGU_mgv1a002489mg [Mimulus guttatus] Length = 667 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCK 1 MVSKKRLD G +GYRAP IP+APRSIR+RGP K Sbjct: 1 MVSKKRLDTGLDGYRAPFIPKAPRSIRRRGPLK 33 >emb|CAC19789.1| MYB-like DNA-binding protein [Catharanthus roseus] Length = 693 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 99 MVSKKRLDYGFNGYRAPVIPRAPRSIRKRGPCK 1 MV K+RL+YGF+GY+ PVIP+APRS+R+RGP K Sbjct: 1 MVLKRRLEYGFSGYQIPVIPKAPRSVRRRGPRK 33