BLASTX nr result
ID: Mentha22_contig00033138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00033138 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22475.1| hypothetical protein MIMGU_mgv1a009299mg [Mimulus... 59 7e-07 >gb|EYU22475.1| hypothetical protein MIMGU_mgv1a009299mg [Mimulus guttatus] Length = 347 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -3 Query: 317 SIIIVIGFYSVMWGKAKEVKVIEKSTDGSSSRNSEKAPLLPIEDEEMR 174 SIIIVIGFYSVMWGKAKEVKV+E NSEKAPLL +++ +R Sbjct: 308 SIIIVIGFYSVMWGKAKEVKVVE---------NSEKAPLLTTDEDPIR 346