BLASTX nr result
ID: Mentha22_contig00032765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00032765 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31984.1| hypothetical protein MIMGU_mgv1a015623mg [Mimulus... 67 2e-09 gb|EYU24992.1| hypothetical protein MIMGU_mgv1a015639mg [Mimulus... 67 2e-09 gb|EXC17873.1| 40S ribosomal protein S13 [Morus notabilis] 67 2e-09 dbj|BAA96366.1| cytoplasmic ribosomal protein S13 [Panax ginseng] 67 2e-09 ref|NP_567151.1| 40S ribosomal protein S13-2 [Arabidopsis thalia... 67 2e-09 ref|XP_007155585.1| hypothetical protein PHAVU_003G214600g [Phas... 67 2e-09 ref|XP_007134868.1| hypothetical protein PHAVU_010G082900g [Phas... 67 2e-09 ref|XP_006421743.1| hypothetical protein CICLE_v10006145mg [Citr... 67 2e-09 ref|XP_006402543.1| hypothetical protein EUTSA_v10006293mg [Eutr... 67 2e-09 ref|XP_006397714.1| hypothetical protein EUTSA_v10001670mg [Eutr... 67 2e-09 ref|XP_006396208.1| hypothetical protein EUTSA_v10029042mg [Eutr... 67 2e-09 gb|EPS68200.1| hypothetical protein M569_06571 [Genlisea aurea] 67 2e-09 gb|EPS66981.1| cytoplasmic ribosomal protein, partial [Genlisea ... 67 2e-09 ref|XP_007038446.1| Ribosomal protein S13A [Theobroma cacao] gi|... 67 2e-09 ref|XP_004511653.1| PREDICTED: 40S ribosomal protein S13-like [C... 67 2e-09 ref|XP_004506541.1| PREDICTED: 40S ribosomal protein S13-like [C... 67 2e-09 ref|XP_006291854.1| hypothetical protein CARUB_v10018030mg [Caps... 67 2e-09 ref|XP_006288849.1| hypothetical protein CARUB_v10002194mg [Caps... 67 2e-09 ref|XP_006284693.1| hypothetical protein CARUB_v10005953mg [Caps... 67 2e-09 ref|XP_004308168.1| PREDICTED: 40S ribosomal protein S13-like [F... 67 2e-09 >gb|EYU31984.1| hypothetical protein MIMGU_mgv1a015623mg [Mimulus guttatus] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >gb|EYU24992.1| hypothetical protein MIMGU_mgv1a015639mg [Mimulus guttatus] gi|604344857|gb|EYU43531.1| hypothetical protein MIMGU_mgv1a015622mg [Mimulus guttatus] gi|604344858|gb|EYU43532.1| hypothetical protein MIMGU_mgv1a015628mg [Mimulus guttatus] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >gb|EXC17873.1| 40S ribosomal protein S13 [Morus notabilis] Length = 131 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 101 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 131 >dbj|BAA96366.1| cytoplasmic ribosomal protein S13 [Panax ginseng] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|NP_567151.1| 40S ribosomal protein S13-2 [Arabidopsis thaliana] gi|27808638|sp|P59224.1|RS132_ARATH RecName: Full=40S ribosomal protein S13-2 gi|13877541|gb|AAK43848.1|AF370471_1 similar to ribosomal protein S13 [Arabidopsis thaliana] gi|6521012|dbj|BAA88058.1| cytoplasmic ribosomal protein S13 [Arabidopsis thaliana] gi|15982874|gb|AAL09784.1| AT4g00100/F6N15_7 [Arabidopsis thaliana] gi|21593617|gb|AAM65584.1| putative ribosomal protein S13 [Arabidopsis thaliana] gi|30102866|gb|AAP21351.1| At4g00100 [Arabidopsis thaliana] gi|332656423|gb|AEE81823.1| 40S ribosomal protein S13-2 [Arabidopsis thaliana] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_007155585.1| hypothetical protein PHAVU_003G214600g [Phaseolus vulgaris] gi|593785091|ref|XP_007155586.1| hypothetical protein PHAVU_003G214600g [Phaseolus vulgaris] gi|561028939|gb|ESW27579.1| hypothetical protein PHAVU_003G214600g [Phaseolus vulgaris] gi|561028940|gb|ESW27580.1| hypothetical protein PHAVU_003G214600g [Phaseolus vulgaris] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_007134868.1| hypothetical protein PHAVU_010G082900g [Phaseolus vulgaris] gi|561007913|gb|ESW06862.1| hypothetical protein PHAVU_010G082900g [Phaseolus vulgaris] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_006421743.1| hypothetical protein CICLE_v10006145mg [Citrus clementina] gi|567905572|ref|XP_006445274.1| hypothetical protein CICLE_v10022677mg [Citrus clementina] gi|568874272|ref|XP_006490240.1| PREDICTED: 40S ribosomal protein S13-like [Citrus sinensis] gi|568875664|ref|XP_006490912.1| PREDICTED: 40S ribosomal protein S13-like [Citrus sinensis] gi|557523616|gb|ESR34983.1| hypothetical protein CICLE_v10006145mg [Citrus clementina] gi|557547536|gb|ESR58514.1| hypothetical protein CICLE_v10022677mg [Citrus clementina] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_006402543.1| hypothetical protein EUTSA_v10006293mg [Eutrema salsugineum] gi|557103642|gb|ESQ43996.1| hypothetical protein EUTSA_v10006293mg [Eutrema salsugineum] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_006397714.1| hypothetical protein EUTSA_v10001670mg [Eutrema salsugineum] gi|557098787|gb|ESQ39167.1| hypothetical protein EUTSA_v10001670mg [Eutrema salsugineum] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_006396208.1| hypothetical protein EUTSA_v10029042mg [Eutrema salsugineum] gi|557097225|gb|ESQ37661.1| hypothetical protein EUTSA_v10029042mg [Eutrema salsugineum] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >gb|EPS68200.1| hypothetical protein M569_06571 [Genlisea aurea] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >gb|EPS66981.1| cytoplasmic ribosomal protein, partial [Genlisea aurea] Length = 143 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 113 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 143 >ref|XP_007038446.1| Ribosomal protein S13A [Theobroma cacao] gi|590723042|ref|XP_007052073.1| Ribosomal protein S13A [Theobroma cacao] gi|508704334|gb|EOX96230.1| Ribosomal protein S13A [Theobroma cacao] gi|508775691|gb|EOY22947.1| Ribosomal protein S13A [Theobroma cacao] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_004511653.1| PREDICTED: 40S ribosomal protein S13-like [Cicer arietinum] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_004506541.1| PREDICTED: 40S ribosomal protein S13-like [Cicer arietinum] gi|502175945|ref|XP_004515770.1| PREDICTED: 40S ribosomal protein S13-like [Cicer arietinum] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_006291854.1| hypothetical protein CARUB_v10018030mg [Capsella rubella] gi|482560561|gb|EOA24752.1| hypothetical protein CARUB_v10018030mg [Capsella rubella] Length = 207 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 177 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 207 >ref|XP_006288849.1| hypothetical protein CARUB_v10002194mg [Capsella rubella] gi|482557555|gb|EOA21747.1| hypothetical protein CARUB_v10002194mg [Capsella rubella] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_006284693.1| hypothetical protein CARUB_v10005953mg [Capsella rubella] gi|482553398|gb|EOA17591.1| hypothetical protein CARUB_v10005953mg [Capsella rubella] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151 >ref|XP_004308168.1| PREDICTED: 40S ribosomal protein S13-like [Fragaria vesca subsp. vesca] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 418 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 326 RIHRLARYYKKTKKLPPVWKYESTTASTLVA Sbjct: 121 RIHRLARYYKKTKKLPPVWKYESTTASTLVA 151